PRGDB00046919 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3241925 (AB015477)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MOK9.

DNA Sequence

ATGGCTGAAGGAGTTGTGTCGTTTGGAGTTCAGAAGCTTTGGGCGCTTCTTAATCGAGAATCCGAGCGATTGAATGGAATAGATGAGCAAGTTGATGGACTAAAGCGTCAGCTGAGAGGGTTACAGTCGCTGTTGAAAGATGCAGATGCAAAGAAACATGGAAGTGATAGGGTGAGGAACTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGAGGAGAAGGAAAAGGGGTCAAGAATCATGTGAGACGACTTGCTTGCTTCTTGACGGATCGCCACAAGGTTGCTTCAGATATCGAGGGTATCACTAAAAGGATCTCTAAGGTGATTGGGGAAATGCAGAGTTTAGGGATACAACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGACATACAGAGGGAGATCCGGCAAACGTTTCCTAACAGCTCTGAAAGCGATCTTGTCGGGGTGGAGCAAAGTGTTGAAGAATTGGTTGGTCCTATGGTGGAAATTGATAACATTCAAGTGGTTTCTATATCTGGGATGGGCGGTATTGGTAAAACCACTTTGGCCAGACAAATCTTTCATCATGATTTAGTCCGGCGTCATTTTGATGGATTCGCATGGGTCTGTGTTTCGCAACAATTTACTCAGAAGCATGTTTGGCAGAGAATCTTGCAAGAACTTCGGCCACACGATGGTGAGATCTTACAGATGGACGAATATACAATCCAGGGTAAACTCTTTCAGTTGTTGGAAACCGGTAGATATTTGGTTGTCCTCGATGATGTATGGAAAGAAGAAGACTGGGATCGAATAAAAGAAGTGTTTCCACGGAAAAGAGGTTGGAAGATGCTACTTACTTCTCGAAATGAAGGAGTTGGGTTACATGCTGATCCAACATGTTTATCTTTTAGAGCAAGAATCCTAAATCCCAAAGAAAGTTGGAAGCTCTTTGAGAGGATAGTCCCTAGAAGAAATGAAACTGAATATGAAGAAATGGAAGCCATCGGAAAGGAAATGGTCACATATTGTGGAGGACTACCATTAGCTGTTAAAGTTTTGGGAGGCTTGTTAGCTAATAAACATACAGCTAGTGAGTGGAAAAGAGTTAGTGAGAATATCGGAGCTCAAATCGTAGGAAAATCGTGCTTAGATGACAACAGTCTCAATTCGGTTTACCGAATATTGTCTTTGAGTTATGAAGATTTGCCAACGGATTTAAAGCATTGTTTCCTTTACCTAGCCCATTTCCCTGAAGATTACAAGATAAAGACACGGACATTGTACAGTTACTGGGCCGCAGAGGGAATTTACGATGGATTAACCATCCTTGATAGTGGAGAAGACTACCTAGAAGAACTAGTGAGGAGAAATTTGGTTATTGCTGAAAAGAGCAATTTGAGTTGGAGACTTAAACTTTGTCAAATGCATGACATGATGAGGGAAGTATGTATATCTAAAGCCAAAGTAGAGAACTTCCTCCAAATTATCAAAGTCCCTACTTCCACCTCTACCATCATTGCTCAATCTCCTAGTAGATCTCGAAGACTCACCGTACATAGTGGTAAAGCCTTTCATATACTAGGACACAAAAAAAAGGTCAGATCTCTTTTAGTTTTGGGACTCAAGGAAGATCTTTGGATACAATCAGCTTCACGCTTCCAAAGCTTACCATTGCTCAGGGTGTTGGATCTGTCTTCGGTAAAATTTGAAGGAGGGAAGTTACCTTCTAGCATTGGAGGGCTCATCCATTTGAGATTCTTGAGCTTACACCAAGCTGTGGTATCTCATCTACCTTCTACTATTCGGAATTTAAAGCTTATGCTCTATTTGAACTTACATGTTGCTATCGGGGTGCCGGTTCACGTGCCAAATGTTTTGAAAGAGATGCTAGAGTTGAGGTACCTTTCCCTACCTCTGGATATGCATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTACTTGTGGTGTTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCGTATGACCAAGCTCAGGTTTTTCGGTGTATCTTTTAGTGAAAGGTGTACTTTTGAAAATCTATCTTCATCTCTCCGTCAATTTCGAAAGCTGGAGACACTTAGTTTCATTTATTCGCGCAAAACCTATATGGTTGATTATGTGGGAGAATTCGTTCTGGATTTTATTCATCTAAAGAAGTTAAGTTTGGGAGTACATTTGTCAAAGATTCCTGATCAACATCAATTACCTCCCCACATTGCACACATATATTTATTGTTTTGCCACATGGAGGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATCTGAAGTCGGTTGAATTAAGACGCAAGGCTTTCATAGGGAGGAGAATGGTGTGCTCAAAAGGCGGGTTTCCTCAATTACGTGCTCTACAAATATCTGAACAATCGGAGTTGGAAGAGTGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTGATTTAATTATACATAGTTGCGAAAAGTTGGAGGAACTTCCTGACGGACTCAAGTATGTAACATCCTTAAAGGAACTGAAGATTGAAGGAATGAAGAGGGAGTGGAAGGAGAAATTGGTTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTTTCAACTGTGACGACGAACAAAGAGAATAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MAEGVVSFGVQKLWALLNRESERLNGIDEQVDGLKRQLRGLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKNHVRRLACFLTDRHKVASDIEGITKRISKVIGEMQSLGIQQQIIDGGRSLSLQDIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIYDGLTILDSGEDYLEELVRRNLVIAEKSNLSWRLKLCQMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCDDEQRE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
2-900 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEGVVSFGVQKLWALLNRESERLNGIDEQVDGLKRQLRGLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKNHVRRLACFLTDRHKVASDIEGITKRISKVIGEMQSLGIQQQIIDGGRSLSLQDIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIYDGLTILDSGEDYLEELVRRNLVIAEKSNLSWRLKLCQMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCDDEQR

HMMPanther: PTHR23155
2-900 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEGVVSFGVQKLWALLNRESERLNGIDEQVDGLKRQLRGLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKNHVRRLACFLTDRHKVASDIEGITKRISKVIGEMQSLGIQQQIIDGGRSLSLQDIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIYDGLTILDSGEDYLEELVRRNLVIAEKSNLSWRLKLCQMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCDDEQR

superfamily: SSF52540
146-391 SSF52540

DIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGK

HMMPfam: PF00931
IPR002182
167-448 NB-ARC,NBS
NB-ARC

EQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIY

Gene3D: G3DSA:3.40.50.300
175-287 G3DSA:3.40.50.300

GPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFP

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

VVSISGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
260-274 DISEASERSIST
Disease resistance protein

LLETGRYLVVLDDVW

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

CGGLPLAVKVLGGLL

superfamily: SSF52058
485-896 SSF52058,LRR

QMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCD

Gene3D: G3DSA:3.80.10.10
562-649 G3DSA:3.80.10.10

SRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLP

FPrintScan: PR00364
IPR000767
565-581 DISEASERSIST
Disease resistance protein

QSLPLLRVLDLSSVKFE

Gene3D: G3DSA:3.80.10.10
698-867 G3DSA:3.80.10.10

RCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEG


List of References

Y Nakamura, S Sato, E Asamizu, T Kaneko, H Kotani, N Miyajima, S Tabata
Structural analysis of Arabidopsis thaliana chromosome 5. VII. Sequence features of the regions of 1,013,767 bp covered by sixteen physically assigned P1 and TAC clones.
DNA Res.: 1998, 5(5);297-308
PubMed:9872454 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox