PRGDB00046920 (DNA-damage-repair/toleration protein-like; disease resistance protein; polygalacturonase inhibitor-like protein)

From PRG Wiki
Jump to: navigation, search
DNA-damage-repair/toleration protein-like; disease resistance protein; polygalacturonase inhibitor-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8051652 (AP002044)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MMF12.

DNA Sequence

ATGAGAAAGTTGTTGGCATCGCCGTTTAGTTCATTACTCGCCGTCGTTTTCATTTCCGTCATCTCCGTCGTCAGATGCTGCTCTCCTAAAGATCAGACGGCTCTCAATGCTTTCAAGTCGTCACTGAGCGAACCAAACCTCGGTATCTTCAACACTTGGTCTGAAAACACTGATTGTTGCAAGGAATGGTACGGTATCAGCTGCGATCCTGATTCGGGTCGGGTCACTGATATTTCTCTCCGGGGAGAATCTGAAGACGCCATTTTCCAAAAGGCAGGCCGGTCCGGTTATATGTCCGGTTCGATTGATCCAGCAGTTTGTGACTTAACCGCACTCACTTCCCTCGTTCTCGCCGACTGGAAAGGAATCACCGGAGAGATTCCTCCGTGCATTACTTCCCTAGCTTCGCTCCGTATCCTCGATCTCGCCGGCAACAAGATCACCGGGGAGATTCCCGCGGAAATCGGCAAACTCTCGAAACTCGCTGTTTTAAACCTCGCCGAGAATCAAATGTCCGGCGAGATTCCGGCGTCACTGACGTCACTCATCGAGTTGAAGCATCTTGAATTGACGGAAAATGGAATCACCGGCGTGATCCCGGCCGATTTCGGATCGTTGAAGATGTTGAGCAGAGTTTTACTGGGCCGTAACGAACTAACCGGGTCAATTCCAGAGTCGATCTCGGGTATGGAACGGTTAGCGGATCTGGATCTATCCAAAAACCATATCGAAGGTCCGATACCCGAATGGATGGGTAACATGAAGGTACTCTCACTTTTGAATCTCGATTGCAATTCGTTAACCGGTCCAATCCCCGGTTCGCTTCTTAGCAATTCCGGTTTAGATGTTGCCAATTTGAGCCGAAATGCGTTGGAAGGAACTATACCCGACGTTTTCGGGTCAAAAACGTATTTAGTTTCGCTTGATCTGTCACACAATAGTCTATCGGGTCGGATCCCGGATTCGTTGTCGTCAGCTAAGTTTGTGGGACATTTGGATATTAGCCATAACAAGCTTTGTGGGCGTATTCCAACGGGTTTTCCTTTTGATCACCTTGAAGCTACGTCGTTTAGTGACAACCAATGTCTCTGCGGTGGCCCTTTGACGACGTCATGTTAA


Protein sequences

Name Description Sequence
DNA-damage-repair/toleration protein-like; disease resistance protein; polygalacturonase inhibitor-like protein DNA-damage-repair/toleration protein-like; disease resistance protein; polygalacturonase inhibitor-like protein [Arabidopsis thaliana].

MRKLLASPFSSLLAVVFISVISVVRCCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGPLTTSC


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF701
1-367 PTHR24420:SF701

MRKLLASPFSSLLAVVFISVISVVRCCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGP

HMMPanther: PTHR24420
1-367 PTHR24420,FAMILY NOT NAMED

MRKLLASPFSSLLAVVFISVISVVRCCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGP

superfamily: SSF52058
25-372 SSF52058,LRR

RCCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGPLTTSC

Gene3D: G3DSA:3.80.10.10
27-70 G3DSA:3.80.10.10

CSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDP

HMMPfam: PF08263
IPR013210
30-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCD

Gene3D: G3DSA:3.80.10.10
106-368 G3DSA:3.80.10.10

VCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGPL

HMMPfam: PF12799
136-172 LRR_4,Leucine Rich repeats (2 copies)

SLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMS

HMMPfam: PF00560
IPR001611
185-206 LRR_1
Leucine-rich repeat

LKHLELTENGITGVIPADFGSL

HMMPfam: PF13855
209-267 LRR_8,Leucine rich repeat

LSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSL

HMMPfam: PF00560
IPR001611
305-325 LRR_1
Leucine-rich repeat

LVSLDLSHNSLSGRIPDSLSS

HMMPfam: PF00560
IPR001611
331-347 LRR_1
Leucine-rich repeat

HLDISHNKLCGRIPTGF


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox