PRGDB00046921 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4757411 (AB026655)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MXC7.

DNA Sequence

ATGATTCGAAGCCAATCTTATTGCTTTCTTGGTATTACTATTACCATCTATTTCTTCTTTTGTCTTCTTCCCTTACCAAACACCTTTGCTTCTCCTCCCACACAGTCTTTGTGCCGCCACGACCAAAGAGATGCTCTTTTGGAGCTACAAAAAGAGTTCCCGATCCCTTCCGTTATTTTACAAAATCCGTGGAACAAGGGCATTGACTGTTGTTCTTGGGGCGGAGTCACGTGTGATGCTATCTTGGGAGAGGTGATATCACTAAAACTCTATTTCCTTAGTACTGCTAGCACCTCTTTGAAATCTAGTAGTGCTCTTTTTAAACTGCAACATCTTACTCACTTAGACCTTTCGAATTGCAATCTCCAAGGGGAGATTCCTTCTTCTATTGAAAATCTTTCCCACCTCACACATCTTGATCTTTCTACTAATCACTTAGTAGGTGAAGTTCCTGCTTCAATCGGTAACCTAAACCAACTAGAATACATAGATCTTAGGGGTAATCATCTCAGAGGTAATATTCCTACTTCATTTGCCAACTTAACCAAGCTTTCTCTATTGGACCTCCATGAAAATAATTTCACGGGTGGTGATATAGTATTATCCAACTTAACCAGCTTAGCGATTCTAGACCTCTCCTCCAATCACTTCAAATCCTTCTTTTCCGCTGACCTAAGTGGACTCCACAACCTGGAGCAAATTTTTGGGAATGAAAACTCATTTGTCGGACTTTTTCCCGCCTCCTTGCTCAAGATTTCTTCGTTAGACAAGATTCAGTTAAGCCAAAACCAATTTGAGGGACCGATTGATTTTGGAAATACGTCTTCATCATCTAGGCTTACAATGTTAGATATCAGCCACAACAATTTTATAGGACGAGTCCCGAGTTCTCTATCTAAATTAGTCAATCTCGAACTTTTAGACCTTAGCCACAACAATTTCAGAGGACTATCCCCTAGATCTATATCTAAGTTAGTCAACCTCACCTCCCTTGATATTTCCTACAACAAGTTGGAAGGTCAAGTACCTTATTTCATATGGAAACCTTCTAACTTGCAATCTGTGGATCTTTCTCATAATTCGTTCTTCGACTTGGGCAAATCTGTGGAAGTTGTCAATGGAGCAAAGTTAGTTGGGTTGAATCTTGGTTCAAATTCACTCCAAGGACCGATTCCCCAATGGATCTGCAACTTCAGATTTGTTTTCTTCTTAGATTTGTCAGACAACCGTTTCACTGGCTCAATTCCTCAATGTTTGAAGAATTCTACTGATTTTAATACGTTAAATCTGCGAAACAACAGTCTAAGTGGGTTTCTGCCAGAATTATGCATGGATAGCACTATGTTACGATCACTTGATGTCAGCTACAACAATTTTGTGGGGAAGCTTCCAAAATCTTTGATGAACTGCCAAGATATGGAATTTTTGAATGTGAGAGGAAACAAGATCAAAGACACGTTTCCATTTTGGTTGGGCTCTCGGAAATCATTAATGGTTCTTGTGCTCCGATCAAATGCATTCTATGGTCCAGTCTATAACTCCACTACCTATTTGGGGTTTCCACGCTTGAGTATCATTGATATATCTAATAACGATTTCGTTGGGTCATTACCACAAGACTATTTTGCCAATTGGACTGAAATGGCAACGGTGTGGGACATCAATCGACTGAACTACGCAAGAAACACTTCTTCAAGAACAATACAATATGGGGGACTTCAAACTATCCAAAGGTCGAACTACGTGGGGGATAATTTCAATATGCATGCAGATTCGATGGATTTGGCGTACAAAGGAGTAGACACAGATTTTAATCGGATCTTTCGAGGCTTTAAAGTCATAGATTTTTCTGGAAACCGATTCTCTGGACATATCCCTAGATCCATTGGTCTATTGAGCGAATTGCTTCATCTCAACTTGTCAGGCAATGCATTCACAGGCAACATCCCTCCATCCTTGGCAAATATCACAAACCTCGAGACGTTAGACCTATCGCGAAATAACTTGTCAGGTGAAATTCCTCGAAGTCTCGGGAACCTCTCGTTTCTGTCCAACATCAACTTCTCCCACAATCATCTACAAGGATTCGTGCCACGGAGCACACAGTTTGGAACTCAAAATTGTTCTTCATTCGTGGGTAATCCTGGACTTTATGGCCTCGATGAAATTTGTAGAGAAAGCCATCATGTTCCTGTTCCTACATCTCAGCAACATGATGGGTCTTCTTCAGAACTAGAAGAGCCAGTGCTGAACTGGATAGCAGCCGCGATAGCCTTTGGACCTGGTGTGTTCTGTGGATTTGTGATCGGACACATCTTCACTTCATACAAACACTTGTGGTTTATAGCTCGTTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MIRSQSYCFLGITITIYFFFCLLPLPNTFASPPTQSLCRHDQRDALLELQKEFPIPSVILQNPWNKGIDCCSWGGVTCDAILGEVISLKLYFLSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHENNFTGGDIVLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNENSFVGLFPASLLKISSLDKIQLSQNQFEGPIDFGNTSSSSRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVFFLDLSDNRFTGSIPQCLKNSTDFNTLNLRNNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLPKSLMNCQDMEFLNVRGNKIKDTFPFWLGSRKSLMVLVLRSNAFYGPVYNSTTYLGFPRLSIIDISNNDFVGSLPQDYFANWTEMATVWDINRLNYARNTSSRTIQYGGLQTIQRSNYVGDNFNMHADSMDLAYKGVDTDFNRIFRGFKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLANITNLETLDLSRNNLSGEIPRSLGNLSFLSNINFSHNHLQGFVPRSTQFGTQNCSSFVGNPGLYGLDEICRESHHVPVPTSQQHDGSSSELEEPVLNWIAAAIAFGPGVFCGFVIGHIFTSYKHLWFIAR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
2-780 PTHR24420:SF473,SUBFAMILY NOT NAMED

IRSQSYCFLGITITIYFFFCLLPLPNTFASPPTQSLCRHDQRDALLELQKEFPIPSVILQNPWNKGIDCCSWGGVTCDAILGEVISLKLYFLSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHENNFTGGDIVLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNENSFVGLFPASLLKISSLDKIQLSQNQFEGPIDFGNTSSSSRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVFFLDLSDNRFTGSIPQCLKNSTDFNTLNLRNNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLPKSLMNCQDMEFLNVRGNKIKDTFPFWLGSRKSLMVLVLRSNAFYGPVYNSTTYLGFPRLSIIDISNNDFVGSLPQDYFANWTEMATVWDINRLNYARNTSSRTIQYGGLQTIQRSNYVGDNFNMHADSMDLAYKGVDTDFNRIFRGFKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLANITNLETLDLSRNNLSGEIPRSLGNLSFLSNINFSHNHLQGFVPRSTQFGTQNCSSFVGNPGLYGLDEICRESHHVPVPTSQQHDGSSSELEEPVLNWIAAAIAFGPGVFCGFVIGHIFTSYKHLW

HMMPanther: PTHR24420
2-780 PTHR24420,FAMILY NOT NAMED

IRSQSYCFLGITITIYFFFCLLPLPNTFASPPTQSLCRHDQRDALLELQKEFPIPSVILQNPWNKGIDCCSWGGVTCDAILGEVISLKLYFLSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHENNFTGGDIVLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNENSFVGLFPASLLKISSLDKIQLSQNQFEGPIDFGNTSSSSRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVFFLDLSDNRFTGSIPQCLKNSTDFNTLNLRNNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLPKSLMNCQDMEFLNVRGNKIKDTFPFWLGSRKSLMVLVLRSNAFYGPVYNSTTYLGFPRLSIIDISNNDFVGSLPQDYFANWTEMATVWDINRLNYARNTSSRTIQYGGLQTIQRSNYVGDNFNMHADSMDLAYKGVDTDFNRIFRGFKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLANITNLETLDLSRNNLSGEIPRSLGNLSFLSNINFSHNHLQGFVPRSTQFGTQNCSSFVGNPGLYGLDEICRESHHVPVPTSQQHDGSSSELEEPVLNWIAAAIAFGPGVFCGFVIGHIFTSYKHLW

superfamily: SSF52058
37-366 SSF52058,LRR

LCRHDQRDALLELQKEFPIPSVILQNPWNKGIDCCSWGGVTCDAILGEVISLKLYFLSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHENNFTGGDIVLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNENSFVGLFPASLLKISSLDKIQLSQNQFEGPIDFGNTSSSSRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFFDLG

Gene3D: G3DSA:3.80.10.10
38-269 G3DSA:3.80.10.10

CRHDQRDALLELQKEFPIPSVILQNPWNKGIDCCSWGGVTCDAILGEVISLKLYFLSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHENNFTGGDIVLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNENSFVGLFPASLLKISSLDKIQLSQNQFEGPI

HMMPfam: PF08263
IPR013210
40-79 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HDQRDALLELQKEFPIPSVILQNPWNKGIDCCSWGGVTCD

HMMPfam: PF13855
103-146 LRR_8,Leucine rich repeat

SSALFKLQHLTHLDLSNCNLQGEIPSSIENLSHLTHLDLSTNHL

ProfileScan: PS51450
IPR001611
111-133 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTHLDLSNCNLQGEIPSSIENL

ProfileScan: PS51450
IPR001611
135-157 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTHLDLSTNHLVGEVPASIGNL

HMMPfam: PF13855
159-217 LRR_8,Leucine rich repeat

QLEYIDLRGNHLRGNIPTSFANLTKLSLLDLHENNFTGGDIVLSNLTSLAILDLSSNHF

ProfileScan: PS51450
IPR001611
159-182 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEYIDLRGNHLRGNIPTSFANLT

ProfileScan: PS51450
IPR001611
183-205 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLSLLDLHENNFTGGDIVLSNLT

ProfileScan: PS51450
IPR001611
206-229 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAILDLSSNHFKSFFSADLSGLH

Gene3D: G3DSA:3.80.10.10
276-413 G3DSA:3.80.10.10

SSSRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVFFLDLSDNRFTG

superfamily: SSF52058
276-543 SSF52058,LRR

SSSRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVFFLDLSDNRFTGSIPQCLKNSTDFNTLNLRNNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLPKSLMNCQDMEFLNVRGNKIKDTFPFWLGSRKSLMVLVLRSNAFYGPVYNSTTYLGFPRLSIIDISNNDFVGSLPQDYFA

HMMPfam: PF13855
278-338 LRR_8,Leucine rich repeat

SRLTMLDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKL

ProfileScan: PS51450
IPR001611
279-302 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTMLDISHNNFIGRVPSSLSKLV

ProfileScan: PS51450
IPR001611
303-324 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLELLDLSHNNFRGLSPRSISK

FPrintScan: PR00019
304-317 LEURICHRPT,Leucine-rich repeat signature

LELLDLSHNNFRGL

ProfileScan: PS51450
IPR001611
327-349 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTSLDISYNKLEGQVPYFIWKP

ProfileScan: PS51450
IPR001611
351-372 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSVDLSHNSFFDLGKSVEVV

Gene3D: G3DSA:3.80.10.10
414-550 G3DSA:3.80.10.10

SIPQCLKNSTDFNTLNLRNNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLPKSLMNCQDMEFLNVRGNKIKDTFPFWLGSRKSLMVLVLRSNAFYGPVYNSTTYLGFPRLSIIDISNNDFVGSLPQDYFANWTEMAT

ProfileScan: PS51450
IPR001611
424-445 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DFNTLNLRNNSLSGFLPELCMD

ProfileScan: PS51450
IPR001611
448-471 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLRSLDVSYNNFVGKLPKSLMNCQ

HMMPfam: PF00560
IPR001611
449-470 LRR_1
Leucine-rich repeat

LRSLDVSYNNFVGKLPKSLMNC

superfamily: SSF52058
612-726 SSF52058,LRR

KVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLANITNLETLDLSRNNLSGEIPRSLGNLSFLSNINFSHNHLQGFVPRSTQFGTQNCSSFVGNPGLYGLDEICRE

Gene3D: G3DSA:3.80.10.10
614-718 G3DSA:3.80.10.10

IDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLANITNLETLDLSRNNLSGEIPRSLGNLSFLSNINFSHNHLQGFVPRSTQFGTQNCSSFVGNPGLY

ProfileScan: PS51450
IPR001611
634-656 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELLHLNLSGNAFTGNIPPSLANI

HMMPfam: PF12799
637-670 LRR_4,Leucine Rich repeats (2 copies)

HLNLSGNAFTGNIPPSLANITNLETLDLSRNNLS

FPrintScan: PR00019
656-669 LEURICHRPT,Leucine-rich repeat signature

ITNLETLDLSRNNL

ProfileScan: PS51450
IPR001611
658-681 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLETLDLSRNNLSGEIPRSLGNLS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox