PRGDB00046922 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4757411 (AB026655)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MXC7.

DNA Sequence

ATGGTTCGAAACCAATCTCGTTGCTTTCTTGGTATTATTATTACCATCTCTTTCTTTTTCTTTCTTCTTTCCTTACCAAACACTTTCGCTTCTCCCACACGGTCTTTGTGCCGCAGCGACCAAAGAGATGCTCTTTTGGAGCTAAAAAAAGAGTTCCCGATCCATTCCAACGGGAGCCATCATGTAACAACACTTTCTTGGAACAAGACCGTTGATTGTTGTTCTTGGGAGGGTGTCACATGTGATGCTACATTAGGAGAGGTGATATCACTTAATCTCGTTTCCTATATTGCCAACACCTCTTTGAAATCTAGCAGTAGTCTTTTTAAACTCCGACATCTTCGTCACCTAGAGCTTTCACATTGCAATCTCCAAGGAGAGATTCCTTCTTCAATTGGAAATCTTTCTCATCTCACATATCTTGATCTTTCTTTCAATCAATTAGTAGGTGAATTTCCGGTTTCGATAGGTAACCTAAACCAACTAGAATACATAGATCTTTGGGTTAATGCTCTCGGAGGTAATATTCCTACTTCATTTGCCAACTTAACAAAGCTTTCTGAATTGCACCTCCGTCAAAATCAATTCACGGGTGGGGATATAGTATTATCCAACTTAACTAGCTTGTCCATTGTAGACCTCTCCTCCAATTACTTCAACTCCACGATTTCTGCTGACCTTAGTCAACTCCACAACTTAGAGCGATTTTGGGTGTCTGAGAACTCATTTTTTGGACCTTTTCCCTCATTCTTGCTCATGATTCCTTCGTTAGTCGATATTTGTTTAAGTGAAAACCAATTCGAAGGACCTATTAATTTTGGGAATACCACTTCGTCATCTAAGTTGACAGAGTTAGATGTTAGCTACAACAATCTTGATGGGCTAATCCCAAAATCTATATCTACATTAGTTAGTCTCGAACATTTAGAGCTTAGCCACAACAATTTTAGAGGACAAGTCCCTAGTTCTATATCGAAATTAGTCAATCTCGATGGTTTATATCTTAGCCATAATAACTTCGGAGGACAAGTCCCTAGCTCTATATTTAAATTAGTCAATCTCGAACATTTAGATCTTAGCCACAACGATTTCGGAGGACGAGTCCCTAGCTCTATATCAAAATTAGTCAACCTCAGTTCCCTTGATCTTTCCTACAACAAGTTTGAAGGTCATGTACCTCAATGTATATGGAGATCTTCTAAGTTAGATTCAGTGGATCTTTCTTATAATTCTTTCAACAGTTTCGGCAGAATTCTAGAACTTGGGGATGAATCATTAGAAAGAGATTGGGATCTTAGCTCAAATTCCCTCCAAGGACCAATTCCCCAATGGATCTGCAACTTCAGATTTTTTTCCTTCTTAGATTTTTCCAACAACCATCTTAATGGCTCAATTCCACAATGTTTGAAGAATTCCACTGATTTCTACATGTTAAATCTGCGAAACAACAGTCTAAGTGGATTTATGCCAGACTTCTGCATGGATGGCTCAATGTTGGGATCACTTGATGTCAGCCTCAACAATTTGGTGGGGAAACTTCCAGAATCTTTCATCAACTGTGAGTGGATGGAATATCTTAATGTGAGAGGAAACAAGATCAAAGACACGTTTCCAGTCTGGTTGGGATCTCTACAATACCTAACGGTTCTTGTGCTCCGATCAAATACATTCTATGGTCCAGTCTATAAGGCCTCTGCCTACTTAGGCTTTCCAAGCATGCGGATCATGGACATATCGAATAACAACTTCGTTGGATCATTGCCACAAGACTATTTTGCCAACTGGACTGAAATGTCATCGGTATGGCAACGACCTATGCTCACACTTGATTACAAAAGAAATATAGCTATACCAGGGTCAAACTACATGGGAGATGATAATCATCAAGATTCAATTGATTTGGTGTATAAAGGAGTAGACACAGATTTCGAACAAATCTTTGGAGGCTTTAAAGTCATAGATTTTTCTGGAAACCGATTCTCTGGACATATCCCTAGATCCATTGGTCTATTGAGCGAATTGCTTCATCTCAACTTGTCAGGCAATGCATTCACAGGAAACATCCCACCATCTTTGGCTAGTATTACAAAGCTCGAGACGCTAGACCTATCGCGAAACAACTTGTCAGGTGAAATTCCTCGAGGTCTCGGGAAACTCTCGTTTCTCTCCAACATCAACTTCTCCCACAACCATCTAGAGGGATTGGTGCCACAAAGCACACAGTTTGGAAGTCAAAATTGTTCTTCATTCATGGGTAATCCCAGACTCTATGGACTCGATCAAATTTGTGGAGAAACCCATGTCCCCATACCTACATCGCTGCACCCCGAGGAACCTTTGTTGGAACCGGAAGAGACAGTTCTGAACTGGATAGCAGCTGCAATAGCATTTGGACCTGGTGTGTTTTGTGGATTAGTGATTGGACATATTTTCACTTCATACAAGCACAAGTGGCTTATGGCGAAATTTTGTCGAAACAAGCGCAAAACCACCATAGGTACTTCTTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MVRNQSRCFLGIIITISFFFFLLSLPNTFASPTRSLCRSDQRDALLELKKEFPIHSNGSHHVTTLSWNKTVDCCSWEGVTCDATLGEVISLNLVSYIANTSLKSSSSLFKLRHLRHLELSHCNLQGEIPSSIGNLSHLTYLDLSFNQLVGEFPVSIGNLNQLEYIDLWVNALGGNIPTSFANLTKLSELHLRQNQFTGGDIVLSNLTSLSIVDLSSNYFNSTISADLSQLHNLERFWVSENSFFGPFPSFLLMIPSLVDICLSENQFEGPINFGNTTSSSKLTELDVSYNNLDGLIPKSISTLVSLEHLELSHNNFRGQVPSSISKLVNLDGLYLSHNNFGGQVPSSIFKLVNLEHLDLSHNDFGGRVPSSISKLVNLSSLDLSYNKFEGHVPQCIWRSSKLDSVDLSYNSFNSFGRILELGDESLERDWDLSSNSLQGPIPQWICNFRFFSFLDFSNNHLNGSIPQCLKNSTDFYMLNLRNNSLSGFMPDFCMDGSMLGSLDVSLNNLVGKLPESFINCEWMEYLNVRGNKIKDTFPVWLGSLQYLTVLVLRSNTFYGPVYKASAYLGFPSMRIMDISNNNFVGSLPQDYFANWTEMSSVWQRPMLTLDYKRNIAIPGSNYMGDDNHQDSIDLVYKGVDTDFEQIFGGFKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLASITKLETLDLSRNNLSGEIPRGLGKLSFLSNINFSHNHLEGLVPQSTQFGSQNCSSFMGNPRLYGLDQICGETHVPIPTSLHPEEPLLEPEETVLNWIAAAIAFGPGVFCGLVIGHIFTSYKHKWLMAKFCRNKRKTTIGTS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-826 PTHR24420,FAMILY NOT NAMED

MVRNQSRCFLGIIITISFFFFLLSLPNTFASPTRSLCRSDQRDALLELKKEFPIHSNGSHHVTTLSWNKTVDCCSWEGVTCDATLGEVISLNLVSYIANTSLKSSSSLFKLRHLRHLELSHCNLQGEIPSSIGNLSHLTYLDLSFNQLVGEFPVSIGNLNQLEYIDLWVNALGGNIPTSFANLTKLSELHLRQNQFTGGDIVLSNLTSLSIVDLSSNYFNSTISADLSQLHNLERFWVSENSFFGPFPSFLLMIPSLVDICLSENQFEGPINFGNTTSSSKLTELDVSYNNLDGLIPKSISTLVSLEHLELSHNNFRGQVPSSISKLVNLDGLYLSHNNFGGQVPSSIFKLVNLEHLDLSHNDFGGRVPSSISKLVNLSSLDLSYNKFEGHVPQCIWRSSKLDSVDLSYNSFNSFGRILELGDESLERDWDLSSNSLQGPIPQWICNFRFFSFLDFSNNHLNGSIPQCLKNSTDFYMLNLRNNSLSGFMPDFCMDGSMLGSLDVSLNNLVGKLPESFINCEWMEYLNVRGNKIKDTFPVWLGSLQYLTVLVLRSNTFYGPVYKASAYLGFPSMRIMDISNNNFVGSLPQDYFANWTEMSSVWQRPMLTLDYKRNIAIPGSNYMGDDNHQDSIDLVYKGVDTDFEQIFGGFKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLASITKLETLDLSRNNLSGEIPRGLGKLSFLSNINFSHNHLEGLVPQSTQFGSQNCSSFMGNPRLYGLDQICGETHVPIPTSLHPEEPLLEPEETVLNWIAAAIAFGPGVFCGLVIGHIFTSYKHKWLMAKFCRN

HMMPanther: PTHR24420:SF911
1-826 PTHR24420:SF911

MVRNQSRCFLGIIITISFFFFLLSLPNTFASPTRSLCRSDQRDALLELKKEFPIHSNGSHHVTTLSWNKTVDCCSWEGVTCDATLGEVISLNLVSYIANTSLKSSSSLFKLRHLRHLELSHCNLQGEIPSSIGNLSHLTYLDLSFNQLVGEFPVSIGNLNQLEYIDLWVNALGGNIPTSFANLTKLSELHLRQNQFTGGDIVLSNLTSLSIVDLSSNYFNSTISADLSQLHNLERFWVSENSFFGPFPSFLLMIPSLVDICLSENQFEGPINFGNTTSSSKLTELDVSYNNLDGLIPKSISTLVSLEHLELSHNNFRGQVPSSISKLVNLDGLYLSHNNFGGQVPSSIFKLVNLEHLDLSHNDFGGRVPSSISKLVNLSSLDLSYNKFEGHVPQCIWRSSKLDSVDLSYNSFNSFGRILELGDESLERDWDLSSNSLQGPIPQWICNFRFFSFLDFSNNHLNGSIPQCLKNSTDFYMLNLRNNSLSGFMPDFCMDGSMLGSLDVSLNNLVGKLPESFINCEWMEYLNVRGNKIKDTFPVWLGSLQYLTVLVLRSNTFYGPVYKASAYLGFPSMRIMDISNNNFVGSLPQDYFANWTEMSSVWQRPMLTLDYKRNIAIPGSNYMGDDNHQDSIDLVYKGVDTDFEQIFGGFKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLASITKLETLDLSRNNLSGEIPRGLGKLSFLSNINFSHNHLEGLVPQSTQFGSQNCSSFMGNPRLYGLDQICGETHVPIPTSLHPEEPLLEPEETVLNWIAAAIAFGPGVFCGLVIGHIFTSYKHKWLMAKFCRN

Gene3D: G3DSA:3.80.10.10
37-289 G3DSA:3.80.10.10

CRSDQRDALLELKKEFPIHSNGSHHVTTLSWNKTVDCCSWEGVTCDATLGEVISLNLVSYIANTSLKSSSSLFKLRHLRHLELSHCNLQGEIPSSIGNLSHLTYLDLSFNQLVGEFPVSIGNLNQLEYIDLWVNALGGNIPTSFANLTKLSELHLRQNQFTGGDIVLSNLTSLSIVDLSSNYFNSTISADLSQLHNLERFWVSENSFFGPFPSFLLMIPSLVDICLSENQFEGPINFGNTTSSSKLTELDVSY

HMMPfam: PF08263
IPR013210
39-82 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SDQRDALLELKKEFPIHSNGSHHVTTLSWNKTVDCCSWEGVTCD

superfamily: SSF52047
90-413 SSF52047,LRR

SLNLVSYIANTSLKSSSSLFKLRHLRHLELSHCNLQGEIPSSIGNLSHLTYLDLSFNQLVGEFPVSIGNLNQLEYIDLWVNALGGNIPTSFANLTKLSELHLRQNQFTGGDIVLSNLTSLSIVDLSSNYFNSTISADLSQLHNLERFWVSENSFFGPFPSFLLMIPSLVDICLSENQFEGPINFGNTTSSSKLTELDVSYNNLDGLIPKSISTLVSLEHLELSHNNFRGQVPSSISKLVNLDGLYLSHNNFGGQVPSSIFKLVNLEHLDLSHNDFGGRVPSSISKLVNLSSLDLSYNKFEGHVPQCIWRSSKLDSVDLSYNSFN

HMMPfam: PF12799
113-148 LRR_4,Leucine Rich repeats (2 copies)

HLRHLELSHCNLQGEIPSSIGNLSHLTYLDLSFNQL

ProfileScan: PS51450
IPR001611
113-135 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRHLELSHCNLQGEIPSSIGNL

ProfileScan: PS51450
IPR001611
137-159 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTYLDLSFNQLVGEFPVSIGNL

ProfileScan: PS51450
IPR001611
185-207 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLSELHLRQNQFTGGDIVLSNLT

ProfileScan: PS51450
IPR001611
208-231 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSIVDLSSNYFNSTISADLSQLH

HMMPfam: PF13516
280-301 LRR_6,Leucine Rich repeat

SKLTELDVSYNNLDGLIPKSIS

ProfileScan: PS51450
IPR001611
281-302 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTELDVSYNNLDGLIPKSIST

FPrintScan: PR00019
282-295 LEURICHRPT,Leucine-rich repeat signature

LTELDVSYNNLDGL

Gene3D: G3DSA:3.80.10.10
290-438 G3DSA:3.80.10.10

NNLDGLIPKSISTLVSLEHLELSHNNFRGQVPSSISKLVNLDGLYLSHNNFGGQVPSSIFKLVNLEHLDLSHNDFGGRVPSSISKLVNLSSLDLSYNKFEGHVPQCIWRSSKLDSVDLSYNSFNSFGRILELGDESLERDWDLSSNSLQ

HMMPfam: PF00560
IPR001611
305-327 LRR_1
Leucine-rich repeat

SLEHLELSHNNFRGQVPSSISKL

ProfileScan: PS51450
IPR001611
305-327 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEHLELSHNNFRGQVPSSISKL

ProfileScan: PS51450
IPR001611
329-351 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLDGLYLSHNNFGGQVPSSIFKL

ProfileScan: PS51450
IPR001611
353-375 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEHLDLSHNDFGGRVPSSISKL

HMMPfam: PF13516
353-373 LRR_6,Leucine Rich repeat

NLEHLDLSHNDFGGRVPSSIS

ProfileScan: PS51450
IPR001611
377-399 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSSLDLSYNKFEGHVPQCIWRS

HMMPfam: PF13516
377-388 LRR_6,Leucine Rich repeat

NLSSLDLSYNKF

ProfileScan: PS51450
IPR001611
401-422 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLDSVDLSYNSFNSFGRILELG

superfamily: SSF52058
428-760 SSF52058,LRR

RDWDLSSNSLQGPIPQWICNFRFFSFLDFSNNHLNGSIPQCLKNSTDFYMLNLRNNSLSGFMPDFCMDGSMLGSLDVSLNNLVGKLPESFINCEWMEYLNVRGNKIKDTFPVWLGSLQYLTVLVLRSNTFYGPVYKASAYLGFPSMRIMDISNNNFVGSLPQDYFANWTEMSSVWQRPMLTLDYKRNIAIPGSNYMGDDNHQDSIDLVYKGVDTDFEQIFGGFKVIDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLASITKLETLDLSRNNLSGEIPRGLGKLSFLSNINFSHNHLEGLVPQSTQFGSQNCSSFMGNPRLYGLD

Gene3D: G3DSA:3.80.10.10
439-600 G3DSA:3.80.10.10

GPIPQWICNFRFFSFLDFSNNHLNGSIPQCLKNSTDFYMLNLRNNSLSGFMPDFCMDGSMLGSLDVSLNNLVGKLPESFINCEWMEYLNVRGNKIKDTFPVWLGSLQYLTVLVLRSNTFYGPVYKASAYLGFPSMRIMDISNNNFVGSLPQDYFANWTEMSS

Gene3D: G3DSA:3.80.10.10
653-756 G3DSA:3.80.10.10

IDFSGNRFSGHIPRSIGLLSELLHLNLSGNAFTGNIPPSLASITKLETLDLSRNNLSGEIPRGLGKLSFLSNINFSHNHLEGLVPQSTQFGSQNCSSFMGNPRL

ProfileScan: PS51450
IPR001611
673-695 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELLHLNLSGNAFTGNIPPSLASI

HMMPfam: PF12799
676-709 LRR_4,Leucine Rich repeats (2 copies)

HLNLSGNAFTGNIPPSLASITKLETLDLSRNNLS

FPrintScan: PR00019
695-708 LEURICHRPT,Leucine-rich repeat signature

ITKLETLDLSRNNL

ProfileScan: PS51450
IPR001611
697-720 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLETLDLSRNNLSGEIPRGLGKLS

ProfileScan: PS51450
IPR001611
721-742 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSNINFSHNHLEGLVPQSTQF


List of References

S Sato, Y Nakamura, T Kaneko, T Katoh, E Asamizu, S Tabata
Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones.
DNA Res.: 2000, 7(2);131-5
PubMed:10819329 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox