PRGDB00046923 (RGH5)

From PRG Wiki
Jump to: navigation, search
RGH5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 16322965 (AY050268)
Gene Class N
Domain Type NBS
Gene Species Theobroma cacao

Comment?

Theobroma cacao isolate G08 disease resistance protein (RGH5) gene, partial cds.

DNA Sequence

GAAGAAGTAGGAATCCCCCAGCCTTCTAACGGGAGTAAGTTAGTGGTAACGACTCGGATGTTGGATGTGTGTCGCTATTTGGGTTGTCGAGAAATTAGAATGCCTACTCCTCCAAAACAAGATGCATGGAGTTTGTTTTTGGAGAAAGTAGGTAAAGATGTTCTCAATTATCCAGGTCTGTTACCAATTGTGGAATCTGTTGTTGAACAATGTGCTGGTTTGCCGCTAGCTATAGTTACAGTAGCTAGCAGTATGAAGGGCATAACAAATGTTCATGAATGGAGGAATGCACGAAATGAATTAAGTAAACGTGTTAGAGGTGTGACTGGGTTAGATGAAAAGGTACTTCAACAACTCCAATTTAGCTATGACCATTTAGAATGTGAAAGAGTCCAGCATTGCTTCCTCTGTTGTGC


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Theobroma cacao].

EEVGIPQPSNGSKLVVTTRMLDVCRYLGCREIRMPTPPKQDAWSLFLEKVGKDVLNYPGLLPIVESVVEQCAGLPLAIVTVASSMKGITNVHEWRNARNELSKRVRGVTGLDEKVLQQLQFSYDHLECERVQHCFLCCA


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
5-139 NB-ARC,NBS
NB-ARC

IPQPSNGSKLVVTTRMLDVCRYLGCREIRMPTPPKQDAWSLFLEKVGKDVLNYPGLLPIVESVVEQCAGLPLAIVTVASSMKGITNVHEWRNARNELSKRVRGVTGLDEKVLQQLQFSYDHLECERVQHCFLCCA

superfamily: SSF52540
10-107 SSF52540

NGSKLVVTTRMLDVCRYLGCREIRMPTPPKQDAWSLFLEKVGKDVLNYPGLLPIVESVVEQCAGLPLAIVTVASSMKGITNVHEWRNARNELSKRVRG


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox