PRGDB00046942 (Mi-1)

From PRG Wiki
Jump to: navigation, search
Mi-1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4050013 (AF091048)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum disease resistance protein (Mi-1) gene, complete cds.

DNA Sequence

ATGGAAAAACGAAAAGATATTGAAGAAGCAAACAACTCATTGGTGTTATTTTCTGCTCTTAGCAAGGACATTGCCAATGTTCTAATTTTCCTAGAGAATGAGGAAAATCAAAAAGCTCTTGACAAAGATCAAGTTGAAAAGCTAAAATTGAAAATGGCATTTATTTGTACATATGTTCAGCTTTCTTATTCCGATTTTGAGCAGTTTGAAGATATAATGACTAGAAATAGACAAGAGGTTGAGAATCTGCTTCAATCACTTTTGGATGATGATGTCCTTACTAGCCTCACCAGTAATATGGATGACTGTATCAGCTTGTATCATCGTTCTTATAAATCAGATGCCATCATGATGGATGAGCAATTGGACTTCCTCCTCTTGAATCTGTATCATCTATCCAAGCATCACGCTGAAAAGATATTTCCTGGAGTGACTCAATATGAAGTTCTTCAGAATGTATGTGGCAACATAAGAGATTTCCATGGGTTGATACTGAATGGTTGCATTAAGCATGAGATGGTTGAGAATGTCTTACCTCTGTTTCAACTCATGGCTGAAAGAGTAGGACACTTCCTTTGGGAGGATCAGACTGATGAAGACTCTCGGCTCTCCGAGCTAGATGAGGATGAACACAATGATAGAGACTCTCGACTCTTCCAGCTAACACATCTACTCTTGAAGATTGTTCCAACTGAACTGGAGGTTATGCACATATGTTATACAAATTTGAAAGCTTCAACTTCAGCAGAAGTTGGACGCTTCATTAAGAAGCTCCTGGAAACCTCACCGGATATTCTCAGAGAATATATCATTCAACTACAAGAGCATATGTTAACTGTTATTCCCCCTAGCACTTTAGGGGCTCGAAACATTCATGTCATGATGGAATTCCTATTACTTATTCTTTCTGATATGCCCAAGGACTTTATTCATCATGACAAACTTTTTGATCTCTTGGCTCATGTTGGAACACTTACCAGGGAGGTATCGACTCTTGTACGTGACTTGGAAGAGAAATTAAGGAATAAAGAGGGTAATAACCAAACAAATTGTGCAACCCTAGACTTGCTGGAAAATATTGAACTCCTCAAGAAAGATCTCAAACATGTTTATCTGAAAGCCCCAAATTCATCTCAATGTTGCTTCCCCATGAGTGATGGACCACTCTTCATGCATCTTCTACACATGCACTTAAATGATTTGCTAGATTCTAATGCTTATTCAATTTCTTTGATAAAGGAAGAAATCGAGTTGGTGAGTCAAGAACTGGAATTCATAAGATCATTCTTTGGGGATGCTGCTGAGCAAGGATTGTATAAAGATATCTGGGCACGTGTTCTAGATGTGGCTTATGAGGCAAAAGATGTCATAGATTCAATTATTGTTCGAGATAATGGTCTCTTACATCTTATTTTCTCACTTCCCATTACCATAAAGAAGATCAAACTTATCAAAGAAGAGATCTCTGCTTTAGATGAGAACATTCCCAAGGACAGAGGTCTAATCGTTGTGAACTCTCCCAAGAAACCAGTTGAGAGAAAGTCATTGACAACTGATAAAATAATTGTAGGTTTTGAGGAGGAGACAAACTTGATACTTAGAAAGCTCACCAGTGGACCCGCAGATTTAGATGTCATTTCGATCACCGGTATGCCGGGTTCAGGTAAAACTACTTTGGCATACAAAGTATACAATGATAAGTCAGTTTCTAGACATTTTGACCTTCGTGCATGGTGCACGGTCGATCAAGGATATGACGACAAGAAGTTGTTGGATACAATTTTCAGTCAAGTTAGTGGCTCAGATTCAAATTTGAGTGAGAATATTGATGTTGCTGATAAATTGCGGAAACAACTGTTTGGAAAGAGGTATCTTATTGTCTTAGATGATGTGTGGGATACTACTACATTGGATGAGTTGACAAGACCTTTTCCTGAAGCTAAGAAAGGAAGTAGGATTATTTTGACAACTCGAGAAAAGGAAGTGGCTTTGCATGGAAAGCTGAACACTGATCCTCTTGACCTTCGATTGCTAAGACCAGATGAAAGTTGGGAACTTTTAGAGAAAAGGACATTTGGTAATGAGAGTTGCCCTGATGAACTATTAGATGTCGGTAAAGAAATAGCCGAAAATTGTAAAGGGCTTCCTTTGGTGGCTGATCTGATTGCTGGAGTCATTGCTGGGAGGGAAAAGAAAAGGAGTGTGTGGCTTGAAGTTCAAAGTAGTTTGAGTTCTTTTATTTTGAACAGTGAAGTGGAAGTGATGAAAGTTATAGAATTAAGTTATGACCATTTACCACATCACCTCAAGCCATGCTTGCTTCACTTTGCAAGTTGGCCGAAGGACACTCCTTTGACAATCTATTTGTTGACTGTTTATTTGGGTGCTGAAGGATTTGTGGAAAAGACGGAGATGAAGGGTATAGAAGAAGTGGTGAAGATTTATATGGATGATTTAATTTCCAGTAGCTTGGTAATTTGTTTCAATGAGATAGGTGATATACTGAATTTCCAAATTCATGATCTTGTGCATGACTTTTGTTTGATAAAAGCAAGAAAGGAAAATTTGTTTGATCGGATAAGATCAAGTGCTCCATCAGATTTGTTGCCTCGTCAAATTACCATTGATTATGATGAGGAGGAGGAGCACTTTGGGCTTAATTTTGTCATGTTCGATTCAAATAAGAAAAGGCATTCTGGTAAACACCTCTATTCTTTGAGGATAAATGGAGACCAGCTGGATGACAGTGTTTCTGATGCATTTCACCTAAGACACTTGAGGCTTATTAGAGTGTTGGACCTGGAACCCTCTTTAATCATGGTGAATGATTCTTTGCTGAATGAAATATGCATGTTGAATCATTTGAGGTACTTAAGAATTCGGACACAAGTTAAATATCTGCCTTTCTCTTTCTCAAACCTCTGGAATCTAGAAAGTCTGTTTGTGTCTAACAAAGGATCAATCTTGGTACTATTACCGAGAATTTTGGATCTTGTAAAGTTGCGAGTGCTGTCCGTGGGTGCTTGTTCTTTCTTTGATATGGATGCAGATGAATCAATATTGATAGCAAAGGACACAAAGTTAGAGAACTTGAGAATATTAGGGGAACTGTTGATTTCCTATTCGAAAGATACAATGAATATTTTCAAAAGGTTTCCCAATCTTCAGGTGCTTCAGTTTGAACTCAAGGAGTCATGGGATTATTCAACAGAGCAACATTGGTTCCCGAAATTGGATTGCCTAACTGAACTAGAAACACTCTGTGTAGGTTTTAAAAGTTCAAACACAAACCACTGTGGGTCCTCTGTTGCGACAAATCGGCCGTGGGATTTTCACTTCCCTTCAAATTTGAAAGAACTGTTGTTGTATGACTTTCCTCTGACATCCGATTCACTATCAACAATAGCGAGACTGCCCAACCTTGAAAATTTGTCCCTTTATGATACAATCATCCAGGGAGAAGAATGGAACATGGGGGAGGAAGACACTTTTGAGAATCTCAAATTTTTGAACTTGCGTCTACTGACTCTTTCCAAGTGGGAGGTTGGAGAGGAATCCTTCCCCAATCTTGAGAAATTAAAACTGCAGGAATGTGGTAAGCTTGAGGAGATTCCACCTAGTTTTGGAGATATTTATTCATTGAAATTTATCAAAATTGTAAAGAGTCCTCAACTTGAAGATTCTGCTCTCAAGATTAAGAAATACGCTGAAGATATGAGAGGAGGGAACGAGCTTCAGATCCTTGGCCAGAAGAATATCCCCTTATTTAAGTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Lycopersicon esculentum].

MEKRKDIEEANNSLVLFSALSKDIANVLIFLENEENQKALDKDQVEKLKLKMAFICTYVQLSYSDFEQFEDIMTRNRQEVENLLQSLLDDDVLTSLTSNMDDCISLYHRSYKSDAIMMDEQLDFLLLNLYHLSKHHAEKIFPGVTQYEVLQNVCGNIRDFHGLILNGCIKHEMVENVLPLFQLMAERVGHFLWEDQTDEDSRLSELDEDEHNDRDSRLFQLTHLLLKIVPTELEVMHICYTNLKASTSAEVGRFIKKLLETSPDILREYIIQLQEHMLTVIPPSTLGARNIHVMMEFLLLILSDMPKDFIHHDKLFDLLAHVGTLTREVSTLVRDLEEKLRNKEGNNQTNCATLDLLENIELLKKDLKHVYLKAPNSSQCCFPMSDGPLFMHLLHMHLNDLLDSNAYSISLIKEEIELVSQELEFIRSFFGDAAEQGLYKDIWARVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITIKKIKLIKEEISALDENIPKDRGLIVVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLLTVYLGAEGFVEKTEMKGIEEVVKIYMDDLISSSLVICFNEIGDILNFQIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEEEEHFGLNFVMFDSNKKRHSGKHLYSLRINGDQLDDSVSDAFHLRHLRLIRVLDLEPSLIMVNDSLLNEICMLNHLRYLRIRTQVKYLPFSFSNLWNLESLFVSNKGSILVLLPRILDLVKLRVLSVGACSFFDMDADESILIAKDTKLENLRILGELLISYSKDTMNIFKRFPNLQVLQFELKESWDYSTEQHWFPKLDCLTELETLCVGFKSSNTNHCGSSVATNRPWDFHFPSNLKELLLYDFPLTSDSLSTIARLPNLENLSLYDTIIQGEEWNMGEEDTFENLKFLNLRLLTLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKIVKSPQLEDSALKIKKYAEDMRGGNELQILGQKNIPLFK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
371-880 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YLKAPNSSQCCFPMSDGPLFMHLLHMHLNDLLDSNAYSISLIKEEIELVSQELEFIRSFFGDAAEQGLYKDIWARVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITIKKIKLIKEEISALDENIPKDRGLIVVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLLTVYLGAEGFVEKTEMKGIEEVVKIYMDDLISSSLVICFNEIGDILNFQIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEE

HMMPanther: PTHR11017:SF14
371-880 PTHR11017:SF14

YLKAPNSSQCCFPMSDGPLFMHLLHMHLNDLLDSNAYSISLIKEEIELVSQELEFIRSFFGDAAEQGLYKDIWARVLDVAYEAKDVIDSIIVRDNGLLHLIFSLPITIKKIKLIKEEISALDENIPKDRGLIVVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLLTVYLGAEGFVEKTEMKGIEEVVKIYMDDLISSSLVICFNEIGDILNFQIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEE

superfamily: SSF52540
503-733 SSF52540

VVNSPKKPVERKSLTTDKIIVGFEEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKR

HMMPfam: PF00931
IPR002182
526-803 NB-ARC,NBS
NB-ARC

EEETNLILRKLTSGPADLDVISITGMPGSGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFILNSEVEVMKVIELSYDHLPHHLKPCLLHFASWPKDTPLTIYLLTVYLGAEGFVEKT

Gene3D: G3DSA:3.40.50.300
529-553 G3DSA:3.40.50.300

TNLILRKLTSGPADLDVISITGMPG

FPrintScan: PR00364
IPR000767
545-560 DISEASERSIST
Disease resistance protein

VISITGMPGSGKTTLA

Gene3D: G3DSA:3.40.50.300
554-721 G3DSA:3.40.50.300

SGKTTLAYKVYNDKSVSRHFDLRAWCTVDQGYDDKKLLDTIFSQVSGSDSNLSENIDVADKLRKQLFGKRYLIVLDDVWDTTTLDELTRPFPEAKKGSRIILTTREKEVALHGKLNTDPLDLRLLRPDESWELLEKRTFGNESCPDELLDVGKEIAENCKGLPLVADL

FPrintScan: PR00364
IPR000767
618-632 DISEASERSIST
Disease resistance protein

QLFGKRYLIVLDDVW

FPrintScan: PR00364
IPR000767
712-726 DISEASERSIST
Disease resistance protein

CKGLPLVADLIAGVI

superfamily: SSF52058
838-1221 SSF52058,LRR

QIHDLVHDFCLIKARKENLFDRIRSSAPSDLLPRQITIDYDEEEEHFGLNFVMFDSNKKRHSGKHLYSLRINGDQLDDSVSDAFHLRHLRLIRVLDLEPSLIMVNDSLLNEICMLNHLRYLRIRTQVKYLPFSFSNLWNLESLFVSNKGSILVLLPRILDLVKLRVLSVGACSFFDMDADESILIAKDTKLENLRILGELLISYSKDTMNIFKRFPNLQVLQFELKESWDYSTEQHWFPKLDCLTELETLCVGFKSSNTNHCGSSVATNRPWDFHFPSNLKELLLYDFPLTSDSLSTIARLPNLENLSLYDTIIQGEEWNMGEEDTFENLKFLNLRLLTLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKIVK

Gene3D: G3DSA:3.80.10.10
901-1055 G3DSA:3.80.10.10

KHLYSLRINGDQLDDSVSDAFHLRHLRLIRVLDLEPSLIMVNDSLLNEICMLNHLRYLRIRTQVKYLPFSFSNLWNLESLFVSNKGSILVLLPRILDLVKLRVLSVGACSFFDMDADESILIAKDTKLENLRILGELLISYSKDTMNIFKRFPNL

Gene3D: G3DSA:3.80.10.10
1115-1170 G3DSA:3.80.10.10

SNLKELLLYDFPLTSDSLSTIARLPNLENLSLYDTIIQGEEWNMGEEDTFENLKFL

FPrintScan: PR00364
IPR000767
1185-1201 DISEASERSIST
Disease resistance protein

ESFPNLEKLKLQECGKL


List of References

P Vos, G Simons, T Jesse, J Wijbrandi, L Heinen, R Hogers, A Frijters, J Groenendijk, P Diergaarde, M Reijans, J Fierens-Onstenk, M de Both, J Peleman, T Liharska, J Hontelez, M Zabeau
The tomato Mi-1 gene confers resistance to both root-knot nematodes and potato aphids.
Nat. Biotechnol.: 1998, 16(13);1365-9
PubMed:9853621 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox