PRGDB00046943 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186492233 (NM_104812)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G61310) mRNA, complete cds.

DNA Sequence

ATGGGGAGTTGTTTTTCTTTTCAAATTGCTGTTGGTGATCAAACGATGAATCGTATCTTTGATTGCTTAATTGGTAAAAGTTATATTCGAACCCTCGAGCAGAATCTCAGAGCTCTGCAGAGGGAAATGGAAGATCTGAGAGCAACTCAACATGAGGTACAGAACAAGGTAGCGAGAGAGGAGTCACGCCATCAACAAAGGCTTGAAGCTGTCCAGGTATGGCTTGACCGTGTCAATAGCATTGATATAGAGTGCAAAGATCTGCTAAGTGTTAGTCCCGTTGAGCTTCAAAAGTTGTGTCTCTGCGGTTTGTGTACAAAATATGTATGTTCAAGCTACAAATATGGGAAAAAGGTATTCTTGTTACTGGAAGAGGTTAAGATACTAAAATCGGAGGGAAATTTTGACGAAGTTTCTCAGCCACCTCCAAGATCTGAAGTTGAAGAGAGGCCTACTCAGCCTACGATAGGTCAAGAAGAAATGCTCGAAAAGGCATGGAACCGCCTTATGGAAGATGGAGTCGGAATCATGGGTCTGCACGGTATGGGTGGTGTAGGCAAAACAACCCTTTTCAAGAAAATCCACAACAAGTTCGCTGAAATAGGTGGTACGTTTGACATTGTGATCTGGATCGTGGTGTCTCAAGGCGCAAAGCTTTCAAAGCTTCAAGAAGATATTGCAGAGAAACTGCACCTTTGTGACGACCTGTGGAAGAACAAGAATGAAAGTGATAAGGCCACTGATATACACAGAGTTTTAAAGGGAAAGAGATTTGTTTTGATGCTAGATGATATATGGGAGAAAGTGGATTTAGAGGCCATTGGTATTCCCTATCCGAGTGAAGTAAATAAATGCAAAGTAGCATTCACGACACGTTCTCGGGAAGTTTGTGGGGAGATGGGGGATCATAAGCCGATGCAAGTCAACTGTTTGGAACCAGAGGATGCATGGGAGTTGTTCAAAAACAAGGTCGGAGACAACACATTAAGTAGTGATCCTGTTATTGTGGGGTTGGCAAGAGAGGTGGCTCAAAAATGTCGTGGTCTGCCATTGGCGCTCAACGTCATTGGTGAGACAATGGCATCTAAAACTATGGTACAAGAATGGGAGTATGCAATCGATGTTTTGACTAGATCCGCTGCAGAGTTTTCTGGCATGGAAAACAAAATTCTTCCGATTCTCAAGTACAGCTACGATAGCTTGGGGGATGAACATATCAAGTCGTGTTTCCTATATTGTGCTCTGTTTCCTGAAGATGGTCAGATATATACCGAAACCTTGATAGACAAATTGATATGCGAAGGATTCATCGGAGAAGACCAAGTTATAAAAAGAGCGAGGAATAAGGGTTATGCGATGCTCGGTACCCTTACCCGTGCAAACTTGCTAACAAAGGTTGGTACAGAACTTGCTAATTTACTAACAAAGGTTAGTATATATCATTGTGTGATGCATGACGTGGTTCGTGAAATGGCTTTATGGATTGCTTCCGATTTTGGGAAACAGAAAGAGAATTTTGTTGTGCAAGCAAGTGCCGGGTTACATGAAATACCAGAAGTCAAGGATTGGGGAGCTGTAAGAAGGATGTCATTAATGAGGAATGAAATTGAAGAGATAACATGCGAGTCCAAGTGTTCTGAACTTACAACTTTGTTCCTTCAAAGTAATCAATTGAAGAATCTATCAGGTGAATTCATTCGGTATATGCAAAAGCTAGTTGTTTTGGATCTTTCAGATAATCGTGACTTCAATGAACTTCCAGAGCAGATATCGGGGCTAGTCTCGTTGCAGTATCTTGACTTGTCGTTTACAAGAATAGAGCAACTGCCTGTTGGCCTCAAAGAGTTGAAAAAGCTAACTTTCCTAGATTTGGCTTATACTGCGCGACTTTGTAGTATCAGTGGGATATCAAGGTTGTTGAGTTTAAGAGTGTTGAGCCTGCTAGGGTCTAAAGTTCATGGAGATGCTAGCGTATTGAAGGAGCTGCAGCAATTGGAGAATCTACAAGATCTAGCCATAACTCTATCCGCCGAGTTAATTAGTTTGGATCAAAGGTTGGCGAAGGTAATCTCTATTCTTGGTATTGAGGGGTTTCTTCAAAAGCCATTCGATTTATCATTCCTGGCGAGTATGGAGAATCTTAGTTCCCTATGGGTGAAAAATAGTTATTTCTCGGAGATAAAGTGCAGAGAAAGCGAGACAGACTCGTCTTATTTACACATCAATCCGAAAATTCCATGCTTTACCAACCTCTCACGACTGGATATAGTGAAGTGCCATAGCATGAAGGATCTGACTTGGATATTGTTTGCTCCAAATCTTGTCGTGCTATTCATTGAAGATTCAAGAGAAGTGGGAGAAATAATAAACAAAGAGAAAGCAACCAATCTTACAAGTATTACACCATTTCTGAAACTAGAAAGGTTGATTTTGTGTTATTTGCCGAAGCTGGAGAGTATCTACTGGAGTCCTCTCCCCTTTCCGCTTTTGTTGAACATAGATGTTGAAGAATGTCCAAAGCTGAGAAAGCTTCCATTAAATGCTACAAGTGCTCCAAAAGTTGAAGAGTTTCGAATACTTATGTATCCTCCAGAACTTGAATGGGAGGACGAAGATACCAAAAATCGATTCTTGCCTGAAATGGTTAGTACTAGTACGTCGTCTAAAGATCCATTACTCAGGAATGGGATTCCTCGCTGTCTAAAATCAGAATCAACGCTTCTTCTTCTTATATTGCTTTATCTATCTTCTTGTAGAGCATTTGGATTGTATAATTGA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MGSCFSFQIAVGDQTMNRIFDCLIGKSYIRTLEQNLRALQREMEDLRATQHEVQNKVAREESRHQQRLEAVQVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCTKYVCSSYKYGKKVFLLLEEVKILKSEGNFDEVSQPPPRSEVEERPTQPTIGQEEMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVGLAREVAQKCRGLPLALNVIGETMASKTMVQEWEYAIDVLTRSAAEFSGMENKILPILKYSYDSLGDEHIKSCFLYCALFPEDGQIYTETLIDKLICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVGTELANLLTKVSIYHCVMHDVVREMALWIASDFGKQKENFVVQASAGLHEIPEVKDWGAVRRMSLMRNEIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSDNRDFNELPEQISGLVSLQYLDLSFTRIEQLPVGLKELKKLTFLDLAYTARLCSISGISRLLSLRVLSLLGSKVHGDASVLKELQQLENLQDLAITLSAELISLDQRLAKVISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETDSSYLHINPKIPCFTNLSRLDIVKCHSMKDLTWILFAPNLVVLFIEDSREVGEIINKEKATNLTSITPFLKLERLILCYLPKLESIYWSPLPFPLLLNIDVEECPKLRKLPLNATSAPKVEEFRILMYPPELEWEDEDTKNRFLPEMVSTSTSSKDPLLRNGIPRCLKSESTLLLLILLYLSSCRAFGLYN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF117
7-903 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

FQIAVGDQTMNRIFDCLIGKSYIRTLEQNLRALQREMEDLRATQHEVQNKVAREESRHQQRLEAVQVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCTKYVCSSYKYGKKVFLLLEEVKILKSEGNFDEVSQPPPRSEVEERPTQPTIGQEEMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVGLAREVAQKCRGLPLALNVIGETMASKTMVQEWEYAIDVLTRSAAEFSGMENKILPILKYSYDSLGDEHIKSCFLYCALFPEDGQIYTETLIDKLICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVGTELANLLTKVSIYHCVMHDVVREMALWIASDFGKQKENFVVQASAGLHEIPEVKDWGAVRRMSLMRNEIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSDNRDFNELPEQISGLVSLQYLDLSFTRIEQLPVGLKELKKLTFLDLAYTARLCSISGISRLLSLRVLSLLGSKVHGDASVLKELQQLENLQDLAITLSAELISLDQRLAKVISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETDSSYLHINPKIPCFTNLSRLDIVKCHSMKDLTWILFAPNLVVLFIEDSREVGEIINKEKATNLTSITPFLKLERLILCYLPKLESIYWSPLPFPLLLNIDVEECPKLRKLPLNATSAPKVEEFRILMYPPELEWEDEDTKNRFLPEMVSTSTSSKDPLLRNGIPRCLKS

HMMPanther: PTHR23155
7-903 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FQIAVGDQTMNRIFDCLIGKSYIRTLEQNLRALQREMEDLRATQHEVQNKVAREESRHQQRLEAVQVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCTKYVCSSYKYGKKVFLLLEEVKILKSEGNFDEVSQPPPRSEVEERPTQPTIGQEEMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVGLAREVAQKCRGLPLALNVIGETMASKTMVQEWEYAIDVLTRSAAEFSGMENKILPILKYSYDSLGDEHIKSCFLYCALFPEDGQIYTETLIDKLICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVGTELANLLTKVSIYHCVMHDVVREMALWIASDFGKQKENFVVQASAGLHEIPEVKDWGAVRRMSLMRNEIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSDNRDFNELPEQISGLVSLQYLDLSFTRIEQLPVGLKELKKLTFLDLAYTARLCSISGISRLLSLRVLSLLGSKVHGDASVLKELQQLENLQDLAITLSAELISLDQRLAKVISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETDSSYLHINPKIPCFTNLSRLDIVKCHSMKDLTWILFAPNLVVLFIEDSREVGEIINKEKATNLTSITPFLKLERLILCYLPKLESIYWSPLPFPLLLNIDVEECPKLRKLPLNATSAPKVEEFRILMYPPELEWEDEDTKNRFLPEMVSTSTSSKDPLLRNGIPRCLKS

Coil: coil
29-64 coiled-coil

IRTLEQNLRALQREMEDLRATQHEVQNKVAREESRH

superfamily: SSF52540
137-382 P-loop containing nucleoside triphosphate hydrolases

EVSQPPPRSEVEERPTQPTIGQEEMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVGLAREVAQKCRGLPLALNVIGETMASKTMVQEWEYAIDVLTRSAAE

HMMPfam: PF00931
IPR002182
158-440 NB-ARC,NBS
NB-ARC

QEEMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVGLAREVAQKCRGLPLALNVIGETMASKTMVQEWEYAIDVLTRSAAEFSGMENKILPILKYSYDSLGDEHIKSCFLYCALFPEDGQIYTETLIDKLICEGFIGED

Gene3D: G3DSA:3.40.50.300
164-266 no description

KAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIW

Seg: seg
173-186 seg

GVGIMGLHGMGGVG

FPrintScan: PR00364
IPR000767
176-191 DISEASERSIST
Disease resistance protein

IMGLHGMGGVGKTTLF

FPrintScan: PR00364
IPR000767
252-266 DISEASERSIST
Disease resistance protein

VLKGKRFVLMLDDIW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM

superfamily: SSF52058
483-859 L domain-like,LRR

VMHDVVREMALWIASDFGKQKENFVVQASAGLHEIPEVKDWGAVRRMSLMRNEIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSDNRDFNELPEQISGLVSLQYLDLSFTRIEQLPVGLKELKKLTFLDLAYTARLCSISGISRLLSLRVLSLLGSKVHGDASVLKELQQLENLQDLAITLSAELISLDQRLAKVISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETDSSYLHINPKIPCFTNLSRLDIVKCHSMKDLTWILFAPNLVVLFIEDSREVGEIINKEKATNLTSITPFLKLERLILCYLPKLESIYWSPLPFPLLLNIDVEECPKLRKLPLNATSAPKVEEFRI

Gene3D: G3DSA:3.80.10.10
513-669 no description

GLHEIPEVKDWGAVRRMSLMRNEIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSDNRDFNELPEQISGLVSLQYLDLSFTRIEQLPVGLKELKKLTFLDLAYTARLCSISGISRLLSLRVLSLLGSKVHGDASVLKELQQLENLQ

HMMPfam: PF13855
547-606 LRR_8,Leucine rich repeat

ELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSDNRDFNELPEQISGLVSLQYLDLSFTRI

FPrintScan: PR00364
IPR000767
567-583 DISEASERSIST
Disease resistance protein

RYMQKLVVLDLSDNRDF

Seg: seg
632-650 seg

SISGISRLLSLRVLSLLGS

Coil: coil
665-686 coiled-coil

LENLQDLAITLSAELISLDQRL

Seg: seg
901-917 seg

LKSESTLLLLILLYLSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox