PRGDB00046944 (disease resistance protein (NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145336923 (NM_104811)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (NBS-LRR class), putative (AT1G61300) mRNA, complete cds.

DNA Sequence

ATGGGGTGTTGTTTTTCTGTCCAGTTTTCTTTTGATGATCAAACCCTGGTACGTATCTTTAATTTCTTATGTGGGAACATCAACAGAAACTCTTTTGGAGTGGAGGAGAGGCCTACTCAGCCTACTATTGGTCAAGAAGAAATGCTCGAAAAGGCATGGAATCGCCTTATGGAAGATAGAGTCGGAATCATGGGTCTTCACGGTATGGGTGGTGTTGGAAAAACCACCCTTTTCAAGAAAATCCACAATAAGTTCGCTAAAATGTCTAGTAGGTTTGACATTGTGATCTGGATCGTGGTGTCTAAAGGCGCAAAGCTTTCAAAGCTTCAAGAAGATATTGCAGAGAAACTACACCTTTGTGACGACCTGTGGAAGAACAAGAATGAAAGTGATAAGGCCACCGATATACACAGAGTCTTAAAGGGCAAGAGATTTGTTTTGATGTTGGATGATATATGGGAGAAAGTGGATTTAGAGGCCATTGGTGTTCCCTATCCGAGTGAAGTAAATAAATGCAAAGTAGCATTCACCACCCGAGATCAAAAAGTTTGTGGGGAGATGGGGGATCATAAGCCGATGCAAGTCAAATGTTTGGAACCAGAGGATGCATGGGAGTTGTTCAAAAACAAGGTCGGAGACAACACATTACGTAGTGATCCCGTCATTGTGGAGTTGGCAAGAGAGGTCGCTCAAAAATGTCGTGGTCTGCCATTGGCGCTCAGTGTCATTGGTGAGACAATGGCATCTAAAACTATGGTACAAGAATGGGAGCATGCAATCGATGTTTTGACTAGATCCGCTGCAGAGTTTTCTAATATGGGAAACAAAATTCTTCCGATTCTCAAGTACAGCTACGATAGCTTGGGGGATGAACATATCAAGTCGTGTTTCCTATATTGTGCTTTGTTTCCCGAAGATGATGAGATATATAACGAAAAGTTGATAGACTACTGGATATGCGAAGGATTCATCGGAGAAGACCAAGTTATAAAAAGAGCGAGGAATAAGGGTTATGAGATGCTCGGTACCCTTACCCTTGCGAACTTGCTAACAAAGGTTGGTACAGAACATGTTGTGATGCATGACGTGGTTCGTGAAATGGCTTTATGGATTGCATCCGATTTTGGGAAACAGAAAGAGAATTTTGTTGTGCGAGCAAGAGTCGGGTTACATGAAAGACCAGAAGCCAAGGATTGGGGAGCTGTGAGAAGGATGTCATTAATGGATAATCATATTGAAGAGATAACATGCGAGTCCAAGTGTTCTGAACTTACAACTTTGTTCCTTCAAAGTAATCAATTGAAGAATCTATCAGGTGAATTCATTCGGTATATGCAAAAGCTAGTTGTTTTAGATCTTTCATATAATCGTGACTTCAATAAACTTCCAGAGCAGATATCGGGGCTGGTCTCGTTGCAGTTTCTTGACTTGTCGAATACAAGTATAAAGCAACTGCCTGTTGGTCTTAAAAAGTTGAAAAAGCTAACTTTTCTGAATTTGGCTTATACTGTGCGACTTTGTAGTATCAGTGGGATATCAAGGTTGTTGAGTTTAAGATTGTTGAGACTGCTAGGGTCTAAAGTTCATGGAGATGCTAGCGTATTGAAGGAGCTGCAGAAATTGCAGAATCTACAACATCTAGCCATAACTCTATCCGCGGAGTTAAGTTTGAATCAAAGGTTGGCGAACTTAATCTCTATTCTTGGTATTGAGGGGTTTCTTCAAAAGCCATTCGATTTATCATTCCTGGCGAGTATGGAGAATCTTAGTTCCCTATGGGTGAAAAATAGTTATTTCTCGGAGATAAAGTGCAGAGAAAGCGAGACGGCCTCGTCTTATTTACGCATCAATCCGAAAATTCCATGCTTTACCAACCTCTCACGACTGGGGTTAAGTAAGTGCCATAGCATAAAGGATCTGACTTGGATATTGTTTGCTCCAAATCTTGTCTACCTATACATTGAAGATTCAAGAGAAGTGGGAGAAATAATAAACAAAGAGAAAGCAACCAATCTTACAAGTATTACACCATTTCTGAAACTAGAAAGGTTGATTTTGTATAATTTGCCGAAGCTGGAGAGTATCTACTGGAGTCCTCTCCACTTTCCACGTTTGTTAATTATACATGTTCTAGACTGTCCAAAGCTGAGAAAGCTTCCATTAAATGCTACAAGTGTCCCACTAGTTGAAGAATTTCAAATACGTATGTATCCTCCAGGACTGGGAAATGAGCTTGAATGGGAGGACGAAGATACCAAAAATCGATTCGTGCTTTCAATCAAGAAGTAG


Protein sequences

Name Description Sequence
disease resistance protein (NBS-LRR class), putative disease resistance protein (NBS-LRR class), putative [Arabidopsis thaliana].

MGCCFSVQFSFDDQTLVRIFNFLCGNINRNSFGVEERPTQPTIGQEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGDHKPMQVKCLEPEDAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAEFSNMGNKILPILKYSYDSLGDEHIKSCFLYCALFPEDDEIYNEKLIDYWICEGFIGEDQVIKRARNKGYEMLGTLTLANLLTKVGTEHVVMHDVVREMALWIASDFGKQKENFVVRARVGLHERPEAKDWGAVRRMSLMDNHIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQKLQNLQHLAITLSAELSLNQRLANLISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETASSYLRINPKIPCFTNLSRLGLSKCHSIKDLTWILFAPNLVYLYIEDSREVGEIINKEKATNLTSITPFLKLERLILYNLPKLESIYWSPLHFPRLLIIHVLDCPKLRKLPLNATSVPLVEEFQIRMYPPGLGNELEWEDEDTKNRFVLSIKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF118
7-760 PTHR23155:SF118,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

VQFSFDDQTLVRIFNFLCGNINRNSFGVEERPTQPTIGQEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGDHKPMQVKCLEPEDAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAEFSNMGNKILPILKYSYDSLGDEHIKSCFLYCALFPEDDEIYNEKLIDYWICEGFIGEDQVIKRARNKGYEMLGTLTLANLLTKVGTEHVVMHDVVREMALWIASDFGKQKENFVVRARVGLHERPEAKDWGAVRRMSLMDNHIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQKLQNLQHLAITLSAELSLNQRLANLISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETASSYLRINPKIPCFTNLSRLGLSKCHSIKDLTWILFAPNLVYLYIEDSREVGEIINKEKATNLTSITPFLKLERLILYNLPKLESIYWSPLHFPRLLIIHVLDCPKLRKLPLNATSVPLVEEFQIRMYPPGLGNELEWEDEDTKNRFVLSI

HMMPanther: PTHR23155
7-760 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VQFSFDDQTLVRIFNFLCGNINRNSFGVEERPTQPTIGQEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGDHKPMQVKCLEPEDAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAEFSNMGNKILPILKYSYDSLGDEHIKSCFLYCALFPEDDEIYNEKLIDYWICEGFIGEDQVIKRARNKGYEMLGTLTLANLLTKVGTEHVVMHDVVREMALWIASDFGKQKENFVVRARVGLHERPEAKDWGAVRRMSLMDNHIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQKLQNLQHLAITLSAELSLNQRLANLISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETASSYLRINPKIPCFTNLSRLGLSKCHSIKDLTWILFAPNLVYLYIEDSREVGEIINKEKATNLTSITPFLKLERLILYNLPKLESIYWSPLHFPRLLIIHVLDCPKLRKLPLNATSVPLVEEFQIRMYPPGLGNELEWEDEDTKNRFVLSI

superfamily: SSF52540
24-269 SSF52540

CGNINRNSFGVEERPTQPTIGQEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGDHKPMQVKCLEPEDAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAE

HMMPfam: PF00931
IPR002182
45-327 NB-ARC,NBS
NB-ARC

QEEMLEKAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGVPYPSEVNKCKVAFTTRDQKVCGEMGDHKPMQVKCLEPEDAWELFKNKVGDNTLRSDPVIVELAREVAQKCRGLPLALSVIGETMASKTMVQEWEHAIDVLTRSAAEFSNMGNKILPILKYSYDSLGDEHIKSCFLYCALFPEDDEIYNEKLIDYWICEGFIGED

Gene3D: G3DSA:3.40.50.300
51-154 G3DSA:3.40.50.300

KAWNRLMEDRVGIMGLHGMGGVGKTTLFKKIHNKFAKMSSRFDIVIWIVVSKGAKLSKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWE

FPrintScan: PR00364
IPR000767
63-78 DISEASERSIST
Disease resistance protein

IMGLHGMGGVGKTTLF

FPrintScan: PR00364
IPR000767
139-153 DISEASERSIST
Disease resistance protein

VLKGKRFVLMLDDIW

FPrintScan: PR00364
IPR000767
233-247 DISEASERSIST
Disease resistance protein

CRGLPLALSVIGETM

superfamily: SSF52058
359-736 SSF52058,LRR

VMHDVVREMALWIASDFGKQKENFVVRARVGLHERPEAKDWGAVRRMSLMDNHIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQKLQNLQHLAITLSAELSLNQRLANLISILGIEGFLQKPFDLSFLASMENLSSLWVKNSYFSEIKCRESETASSYLRINPKIPCFTNLSRLGLSKCHSIKDLTWILFAPNLVYLYIEDSREVGEIINKEKATNLTSITPFLKLERLILYNLPKLESIYWSPLHFPRLLIIHVLDCPKLRKLPLNATSVPLVEEFQIRM

Gene3D: G3DSA:3.80.10.10
396-549 G3DSA:3.80.10.10

AKDWGAVRRMSLMDNHIEEITCESKCSELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNLAYTVRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQKLQNLQHLAI

HMMPfam: PF13855
423-482 LRR_8,Leucine rich repeat

ELTTLFLQSNQLKNLSGEFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSI

FPrintScan: PR00364
IPR000767
443-459 DISEASERSIST
Disease resistance protein

RYMQKLVVLDLSYNRDF

Gene3D: G3DSA:3.80.10.10
585-722 G3DSA:3.80.10.10

SMENLSSLWVKNSYFSEIKCRESETASSYLRINPKIPCFTNLSRLGLSKCHSIKDLTWILFAPNLVYLYIEDSREVGEIINKEKATNLTSITPFLKLERLILYNLPKLESIYWSPLHFPRLLIIHVLDCPKLRKLPLN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox