PRGDB00046953 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145336920 (NM_104799)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G61180) mRNA, complete cds.

DNA Sequence

ATGGGGAGTTGTTTTTCTCTTCAAGTTAGTGATCAAACACTGAATCGTATCTTTAATTGCTTAATTGGTAAAAGTTATATTCGAACCCTCGAGAAGAATCTCAGAGCTCTGCAGAGGGAAATGGAAGATCTCAGAGCAATTCAACATGAGGTACAAAACAAGGTAGCTAGAGACGAGGCACGCCATCAACGAAGGCTTGAAGCTGTCCAGGTATGGCTTGACCGTGTCAATAGCGTTGATATAGAGTGCAAAGATCTGCTAAGTGTTACTCCTGTTGAGCTTCAAAAGTTGTGTCTATGCGGTTTGTGTTCAAAATATGTATGTTCAAGCTACAAATATGGGAAAAAGGTATTCTTGTTACTGGAAGAGGTTAAGAAACTAAACTCGGAGGGAAATTTTGACGAGGTTTCTCAGCCGCCTCCAAGGTCTGAAGTTGAAGAGAGGCCTACTCAGCCTACGATTGGTCAGGAAGACATGCTCGAAAAGGCATGGAACCGCCTTATGGAAGATGGAGTCGGAATCATGGGTCTGCACGGTATGGGTGGTGTAGGCAAAACAACCCTTTTCAAGAAAATCCACAACAAGTTCGCTGAAATAGGTGGTACGTTTGACATTGTGATCTGGATCGTGGTGTCTAAAGGCGTAATGATTTCAAAGCTTCAAGAAGATATTGCAGAGAAACTACACCTTTGTGACGACCTGTGGAAGAACAAGAATGAAAGTGATAAGGCCACTGATATACACAGAGTTTTAAAGGGCAAGAGATTTGTTTTGATGCTAGATGATATATGGGAGAAAGTGGATTTAGAGGCCATTGGTATTCCCTATCCGAGTGAAGTAAATAAATGCAAAGTAGCATTCACGACACGTTCTCGGGAAGTTTGTGGGGAGATGGGGGATCATAAGCCGATGCAAGTCAACTGTTTGGAACCAGAGGATGCATGGGAGCTGTTCAAAAACAAGGTCGGAGACAACACATTAAGTAGTGATCCTGTTATTGTGGAGTTGGCAAGAGAGGTCGCTCAAAAATGTCGTGGTCTGCCATTGGCGCTCAACGTCATTGGTGAGACAATGTCATCTAAAACTATGGTACAAGAATGGGAGCATGCAATCCATGTTTTTAATACATCCGCTGCAGAGTTTTCTGACATGCAAAACAAAATTCTTCCGATTCTCAAGTACAGCTACGATAGCTTGGGGGATGAACATATCAAGTCGTGTTTCCTATATTGTGCTCTGTTTCCTGAAGATGGTGAGATATATAACGAAAAGTTGATAGACTACTGGATATGCGAAGGATTCATCGGAGAAGACCAAGTTATAAAAAGAGCGAGGAATAAGGGTTATGCGATGCTCGGTACCCTTACCCGTGCAAATTTGCTAACAAAGGTTGGTACATATTATTGTGTGATGCATGACGTGGTTCGTGAAATGGCTTTATGGATTGCTTCCGATTTTGGGAAACAGAAAGAGAATTTTGTTGTGCAAGCAGGAGTCGGGTTACATGAAATACCAAAAGTCAAGGATTGGGGAGCTGTAAGAAAGATGTCATTAATGGATAATGATATTGAAGAGATAACATGCGAGTCCAAGTGTTCTGAACTTACAACTTTGTTCCTTCAAAGTAATAAATTGAAGAATCTACCAGGTGCATTCATTCGGTATATGCAAAAGCTAGTTGTTTTGGATCTTTCATATAATCGTGACTTCAATAAACTTCCAGAGCAGATATCGGGGCTGGTCTCGTTGCAGTTTCTTGACTTGTCGAATACAAGTATAGAGCACATGCCTATTGGTCTCAAAGAGTTGAAAAAGCTAACTTTCCTGGATTTGACTTATACTGATCGACTTTGTAGTATCAGTGGGATATCAAGGTTGTTGAGTTTAAGATTGTTGAGACTGCTAGGGTCTAAAGTTCATGGAGATGCTAGCGTATTGAAGGAGCTGCAGCAATTGCAGAATCTACAAGAGCTAGCCATAACTGTATCCGCGGAGTTAATTAGTTTGGATCAAAGGTTGGCGAAGTTAATCTCTAATCTTTGTATTGAAGGGTTTCTTCAAAAGCCATTCGATTTATCATTCTTGGCGAGTATGGAGAATCTTAGTTCCCTACGGGTGGAAAATAGTTATTTCTCGGAGATAAAGTGCAGAGAAAGCGAGACAGAATCGTCTTATTTACGCATCAATCCGAAAATTCCATGCTTTACCAACCTCTCACGACTGGAGATAATGAAGTGCCATAGCATGAAGGATCTGACTTGGATATTGTTTGCTCCAAATCTTGTCGTGCTACTCATTGAAGATTCAAGAGAAGTGGGAGAAATAATAAACAAAGAGAAAGCAACCAATCTTACAAGTATTACACCATTTCTGAAACTAGAATGGTTGATTTTGTATAATTTGCCGAAGCTGGAGAGTATCTACTGGAGTCCTCTCCCCTTTCCGGTTTTGTTGACCATGGATGTTTCAAACTGTCCAAAGCTGAGAAAGCTTCCATTAAATGCTACAAGTGTTTCAAAAGTTGAAGAATTTGAAATACATATGTATCCTCCTCCAGAACAGGAAAATGAGCTTGAATGGGAGGACGATGATACCAAAAATCGATTCTTGCCTTCAATCAAACCGTACAAGTACTTCGTCTACCCAGGAATGAGTTTCCTCACTGTCTAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MGSCFSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLEAVQVWLDRVNSVDIECKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFLLLEEVKKLNSEGNFDEVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVGTYYCVMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPYKYFVYPGMSFLTV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF117
5-889 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

FSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLEAVQVWLDRVNSVDIECKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFLLLEEVKKLNSEGNFDEVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVGTYYCVMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPYKYFVYPGMSFLTV

HMMPanther: PTHR23155
5-889 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLEAVQVWLDRVNSVDIECKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFLLLEEVKKLNSEGNFDEVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVGTYYCVMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPYKYFVYPGMSFLTV

Coil: coil
27-55 coiled-coil

IRTLEKNLRALQREMEDLRAIQHEVQNKV

Seg: seg
115-127 seg

KKVFLLLEEVKKL

superfamily: SSF52540
135-369 P-loop containing nucleoside triphosphate hydrolases

EVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEH

HMMPfam: PF00931
IPR002182
156-438 NB-ARC,NBS
NB-ARC

QEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGED

Gene3D: G3DSA:3.40.50.300
164-264 no description

WNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIW

Seg: seg
171-184 seg

GVGIMGLHGMGGVG

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

IMGLHGMGGVGKTTLF

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

VLKGKRFVLMLDDIW

FPrintScan: PR00364
IPR000767
344-358 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM

superfamily: SSF52058
470-848 L domain-like,LRR

VMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHM

Gene3D: G3DSA:3.80.10.10
501-834 no description

LHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLN

HMMPfam: PF13855
534-593 LRR_8,Leucine rich repeat

ELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSI

FPrintScan: PR00364
IPR000767
554-570 DISEASERSIST
Disease resistance protein

RYMQKLVVLDLSYNRDF

Seg: seg
616-637 seg

RLCSISGISRLLSLRLLRLLGS

Seg: seg
648-658 seg

ELQQLQNLQEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox