PRGDB00046954 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18403541 (NM_104026)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G51480) mRNA, complete cds.

DNA Sequence

ATGGTGCAGCACTGGGATGGTGACCCAGCTGTGAGAACCAAAAGTCACATAGAGATGTTGCACCCTGCTTGTGAGATGTCCTGGAACTTGAAGCAACATGACGACACCGCTGCAAGCTTAATGGTGATCCAAAGTCCAACATCTGATCCAGTTTTCAACCCGGTTCACACCATTAAGCAATTTGGGGAACGTTACACCCAAGATTTTGTGATACGTGAACGTGATAAGAGTTTTGGTGTTTTGATTCATTGTTTTTGCAAAATGGCGGATTGGCTTCTACTAATACCCTGGAACAAGATCTTCACTGCTGCATGTGGCTGCTTTTTTAGCGATAGAAACTACATTCACAAGATGGAGGCAAATCTCGATGATCTGCACACAACTATGGAAGAACTTAAGAATGGACGAGATGATTTGTTAAGAAGAGTTTCCATAGAAGAAGATAAAGGTTTGCAACAGCTTGCTCAAGTCAAAGGATGGATTTCAAGGGTAGAAATTGTTGAATCTAGATTCAAGGATCTGCTTGAGGATAAATCAACTGAAACTGGAAGATTGTGTTTGTTTGGATTTTGTTCTGAGAATTGCATATCAAGCTACAATTATGGTGAAAAGGTAATGAAGAATCTGGAAGAAGTTAAAGAACTTCTATCTAAAAAACATTTTGAAGTGGTGGCGCATAAGATTCCTGTACCTAAGGTAGAGGAGAAGAATATCCATACCACAGTTGGTTTGTATGCAATGGTTGAAATGGCATGGAAAAGCCTCATGAATGATGAAATAAGAACCTTGTGTCTTCATGGTATGGGGGGAGTAGGAAAAACCACACTCTTAGCTTGCATCAACAACAAATTCGTTGAACTGGAGAGTGAATTTGATGTTGTGATATGGGTTGTGGTATCTAAAGACTTTCAGCTTGAGGGTATTCAAGATCAGATTCTTGGTAGATTACGTCTCGACAAGGAATGGGAAAGAGAAACAGAAAATAAGAAAGCCTCACTCATAAACAATAACCTTAAGAGAAAAAAATTTGTGCTGTTGTTGGATGATCTCTGGAGCGAGGTAGATCTGAACAAGATAGGAGTTCCACCTCCAACTCGTGAAAATGGAGCGAAGATAGTTTTCACCAAACGTTCAAAGGAAGTTTCCAAGTACATGAAAGCTGACATGCAAATAAAAGTTTCTTGTTTGTCACCAGATGAAGCGTGGGAATTGTTTCGAATTACTGTTGATGATGTCATATTAAGCAGCCATGAAGATATTCCTGCACTCGCAAGAATAGTTGCTGCAAAATGTCATGGCTTGCCACTTGCACTCATTGTCATTGGGGAAGCCATGGCATGTAAAGAGACTATACAAGAATGGCATCATGCGATTAATGTTCTGAATTCGCCTGCAGGCCACAAGTTTCCAGGTATGGAAGAAAGAATTCTTCTCGTTTTGAAGTTCAGTTACGATAGCTTGAAGAATGGTGAAATCAAATTGTGTTTCCTATATTGTTCTTTGTTTCCTGAAGATTTTGAAATAGAGAAGGAGAAGTTGATAGAATACTGGATTTGCGAAGGATATATAAATCCGAACAGATATGAAGATGGAGGTACCAACCAAGGTTATGATATAATTGGCTTGTTAGTTCGTGCACATTTGTTGATTGAATGTGAACTCACCACCAAAGTTAAAATGCATTATGTGATACGTGAGATGGCTCTTTGGATAAATTCTGACTTTGGAAAACAGCAAGAAACAATCTGTGTGAAATCTGGTGCTCATGTACGTATGATACCGAATGACATCAATTGGGAGATTGTAAGACAAGTGTCTTTAATCAGTACTCAGATTGAGAAGATATCTTGTAGTTCCAAATGCTCCAACCTTTCAACCCTATTACTCCCGTATAACAAGTTGGTGAATATTTCAGTTGGATTCTTTCTGTTTATGCCAAAACTTGTGGTCTTGGATCTTTCTACAAACATGAGTCTTATTGAATTACCGGAGGAAATTTCTAACTTATGTTCTCTTCAATATCTTAATTTATCAAGCACAGGGATAAAATCGCTACCAGGTGGTATGAAGAAGTTGAGGAAACTAATCTACTTGAATCTGGAGTTCAGTTATAAACTTGAGAGTCTTGTTGGCATATCAGCAACCTTACCAAATCTGCAAGTGTTGAAATTATTTTATTCCAATGTTTGTGTTGATGACATATTAATGGAGGAACTACAACACATGGATCACTTGAAGATTTTAACGGTAACCATAGATGATGCCATGATTTTGGAAAGGATACAAGGTATTGACCGATTGGCGAGTAGTATTCGAGGTTTATGTCTAACAAATATGTCAGCACCTCGTGTAGTATTAAGTACGACAGCTCTGGGAGGTCTTCAACAACTTGCAATTCTGAGCTGCAACATATCTGAGATAAAGATGGATTGGAAAAGCAAAGAAAGAAGGGAGGTTTCACCAATGGAGATTCATCCATCTACAAGTACAAGTTCTCCAGGCTTCAAGCAACTCTCCAGTGTTAATATAATGAAATTGGTAGGGCCAAGGGATTTGTCATGGCTGTTATTTGCTCAAAATCTAAAGAGTCTACATGTGGGCTTTTCACCAGAAATAGAAGAAATTATAAATAAGGAGAAAGGATCGAGTATTACCAAAGAAATTGCCTTTGGAAAATTGGAATCACTTGTAATATATAAATTGCCTGAACTCAAGGAAATTTGCTGGAATTATCGGACTCTTCCTAACAGTAGATATTTTGATGTCAAAGATTGTCCAAAGCTACCTGAAGATATTGCTAATTTTCCCATGCATGCAGAGGAATAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MVQHWDGDPAVRTKSHIEMLHPACEMSWNLKQHDDTAASLMVIQSPTSDPVFNPVHTIKQFGERYTQDFVIRERDKSFGVLIHCFCKMADWLLLIPWNKIFTAACGCFFSDRNYIHKMEANLDDLHTTMEELKNGRDDLLRRVSIEEDKGLQQLAQVKGWISRVEIVESRFKDLLEDKSTETGRLCLFGFCSENCISSYNYGEKVMKNLEEVKELLSKKHFEVVAHKIPVPKVEEKNIHTTVGLYAMVEMAWKSLMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLINNNLKRKKFVLLLDDLWSEVDLNKIGVPPPTRENGAKIVFTKRSKEVSKYMKADMQIKVSCLSPDEAWELFRITVDDVILSSHEDIPALARIVAAKCHGLPLALIVIGEAMACKETIQEWHHAINVLNSPAGHKFPGMEERILLVLKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKEKLIEYWICEGYINPNRYEDGGTNQGYDIIGLLVRAHLLIECELTTKVKMHYVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRQVSLISTQIEKISCSSKCSNLSTLLLPYNKLVNISVGFFLFMPKLVVLDLSTNMSLIELPEEISNLCSLQYLNLSSTGIKSLPGGMKKLRKLIYLNLEFSYKLESLVGISATLPNLQVLKLFYSNVCVDDILMEELQHMDHLKILTVTIDDAMILERIQGIDRLASSIRGLCLTNMSAPRVVLSTTALGGLQQLAILSCNISEIKMDWKSKERREVSPMEIHPSTSTSSPGFKQLSSVNIMKLVGPRDLSWLLFAQNLKSLHVGFSPEIEEIINKEKGSSITKEIAFGKLESLVIYKLPELKEICWNYRTLPNSRYFDVKDCPKLPEDIANFPMHAEE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF114
93-936 PTHR23155:SF114,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LLIPWNKIFTAACGCFFSDRNYIHKMEANLDDLHTTMEELKNGRDDLLRRVSIEEDKGLQQLAQVKGWISRVEIVESRFKDLLEDKSTETGRLCLFGFCSENCISSYNYGEKVMKNLEEVKELLSKKHFEVVAHKIPVPKVEEKNIHTTVGLYAMVEMAWKSLMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLINNNLKRKKFVLLLDDLWSEVDLNKIGVPPPTRENGAKIVFTKRSKEVSKYMKADMQIKVSCLSPDEAWELFRITVDDVILSSHEDIPALARIVAAKCHGLPLALIVIGEAMACKETIQEWHHAINVLNSPAGHKFPGMEERILLVLKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKEKLIEYWICEGYINPNRYEDGGTNQGYDIIGLLVRAHLLIECELTTKVKMHYVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRQVSLISTQIEKISCSSKCSNLSTLLLPYNKLVNISVGFFLFMPKLVVLDLSTNMSLIELPEEISNLCSLQYLNLSSTGIKSLPGGMKKLRKLIYLNLEFSYKLESLVGISATLPNLQVLKLFYSNVCVDDILMEELQHMDHLKILTVTIDDAMILERIQGIDRLASSIRGLCLTNMSAPRVVLSTTALGGLQQLAILSCNISEIKMDWKSKERREVSPMEIHPSTSTSSPGFKQLSSVNIMKLVGPRDLSWLLFAQNLKSLHVGFSPEIEEIINKEKGSSITKEIAFGKLESLVIYKLPELKEICWNYRTLPNSRYFDVKDCPKLPEDIANFP

HMMPanther: PTHR23155
93-936 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLIPWNKIFTAACGCFFSDRNYIHKMEANLDDLHTTMEELKNGRDDLLRRVSIEEDKGLQQLAQVKGWISRVEIVESRFKDLLEDKSTETGRLCLFGFCSENCISSYNYGEKVMKNLEEVKELLSKKHFEVVAHKIPVPKVEEKNIHTTVGLYAMVEMAWKSLMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLINNNLKRKKFVLLLDDLWSEVDLNKIGVPPPTRENGAKIVFTKRSKEVSKYMKADMQIKVSCLSPDEAWELFRITVDDVILSSHEDIPALARIVAAKCHGLPLALIVIGEAMACKETIQEWHHAINVLNSPAGHKFPGMEERILLVLKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKEKLIEYWICEGYINPNRYEDGGTNQGYDIIGLLVRAHLLIECELTTKVKMHYVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRQVSLISTQIEKISCSSKCSNLSTLLLPYNKLVNISVGFFLFMPKLVVLDLSTNMSLIELPEEISNLCSLQYLNLSSTGIKSLPGGMKKLRKLIYLNLEFSYKLESLVGISATLPNLQVLKLFYSNVCVDDILMEELQHMDHLKILTVTIDDAMILERIQGIDRLASSIRGLCLTNMSAPRVVLSTTALGGLQQLAILSCNISEIKMDWKSKERREVSPMEIHPSTSTSSPGFKQLSSVNIMKLVGPRDLSWLLFAQNLKSLHVGFSPEIEEIINKEKGSSITKEIAFGKLESLVIYKLPELKEICWNYRTLPNSRYFDVKDCPKLPEDIANFP

superfamily: SSF52540
223-456 SSF52540

VVAHKIPVPKVEEKNIHTTVGLYAMVEMAWKSLMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLINNNLKRKKFVLLLDDLWSEVDLNKIGVPPPTRENGAKIVFTKRSKEVSKYMKADMQIKVSCLSPDEAWELFRITVDDVILSSHEDIPALARIVAAKCHGLPLALIVIGEAMACKETIQEWHH

HMMPfam: PF00931
IPR002182
247-526 NB-ARC,NBS
NB-ARC

MVEMAWKSLMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLINNNLKRKKFVLLLDDLWSEVDLNKIGVPPPTRENGAKIVFTKRSKEVSKYMKADMQIKVSCLSPDEAWELFRITVDDVILSSHEDIPALARIVAAKCHGLPLALIVIGEAMACKETIQEWHHAINVLNSPAGHKFPGMEERILLVLKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKEKLIEYWICEGYINPN

Gene3D: G3DSA:3.40.50.300
255-351 G3DSA:3.40.50.300

LMNDEIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLINNNLKRKKFVLLLDDLW

HMMSmart: SM00382
IPR003593
259-438 AAA,NBS
AAA+ ATPase domain

EIRTLCLHGMGGVGKTTLLACINNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRLDKEWERETENKKASLINNNLKRKKFVLLLDDLWSEVDLNKIGVPPPTRENGAKIVFTKRSKEVSKYMKADMQIKVSCLSPDEAWELFRITVDDVILSSHEDIPALARIVAAKCHGLPLAL

FPrintScan: PR00364
IPR000767
262-277 DISEASERSIST
Disease resistance protein

TLCLHGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
337-351 DISEASERSIST
Disease resistance protein

NLKRKKFVLLLDDLW

Gene3D: G3DSA:3.80.10.10
352-356 G3DSA:3.80.10.10

SEVDL

FPrintScan: PR00364
IPR000767
431-445 DISEASERSIST
Disease resistance protein

CHGLPLALIVIGEAM

superfamily: SSF52058
574-928 SSF52058,LRR

DFGKQQETICVKSGAHVRMIPNDINWEIVRQVSLISTQIEKISCSSKCSNLSTLLLPYNKLVNISVGFFLFMPKLVVLDLSTNMSLIELPEEISNLCSLQYLNLSSTGIKSLPGGMKKLRKLIYLNLEFSYKLESLVGISATLPNLQVLKLFYSNVCVDDILMEELQHMDHLKILTVTIDDAMILERIQGIDRLASSIRGLCLTNMSAPRVVLSTTALGGLQQLAILSCNISEIKMDWKSKERREVSPMEIHPSTSTSSPGFKQLSSVNIMKLVGPRDLSWLLFAQNLKSLHVGFSPEIEEIINKEKGSSITKEIAFGKLESLVIYKLPELKEICWNYRTLPNSRYFDVKDCPKL

Gene3D: G3DSA:3.80.10.10
600-754 G3DSA:3.80.10.10

EIVRQVSLISTQIEKISCSSKCSNLSTLLLPYNKLVNISVGFFLFMPKLVVLDLSTNMSLIELPEEISNLCSLQYLNLSSTGIKSLPGGMKKLRKLIYLNLEFSYKLESLVGISATLPNLQVLKLFYSNVCVDDILMEELQHMDHLKILTVTIDD

HMMPfam: PF13855
622-681 LRR_8,Leucine rich repeat

SNLSTLLLPYNKLVNISVGFFLFMPKLVVLDLSTNMSLIELPEEISNLCSLQYLNLSSTG

FPrintScan: PR00364
IPR000767
643-659 DISEASERSIST
Disease resistance protein

LFMPKLVVLDLSTNMSL

Gene3D: G3DSA:3.80.10.10
879-927 G3DSA:3.80.10.10

EKGSSITKEIAFGKLESLVIYKLPELKEICWNYRTLPNSRYFDVKDCPK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox