PRGDB00046956 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18407797 (NM_105014)
Gene Class NL
Domain Type LRR, LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G63350) mRNA, complete cds.

DNA Sequence

ATGGGTATCTCTTTCTCGATACCCTTTGATCCGTGTGTAAATAAAGTCTCTCAATGGCTAGACATGAAAGTAAGTTATACTCACAACCTCGAGAAGAATCTTGTGGCTCTCGAGACAACCATGGAAGAGCTCAAGGCCAAGCGGGATGATTTATTAAGAAAGCTCAAAAGAGAGGAGGATAGAGGTCTACAAACGCTTGGCGAAATCAAGGTATGGCTTAATAGAGTTGAGACTATCGAAAGCAGAGTCAATGATCTTCTTAATGCTAGAAATGCTGAACTTCAAAGGCTGTGCCTTTGTGGGTTTTGCTCTAAGAGTTTAACGACGAGCTATCGTTATGGGAAAAGTGTTTTCTTGAAATTGAGGGAGGTTGAGAAACTCGAAAGGAGAGTTTTTGAAGTGATTTCTGATCAAGCTTCAACATCTGAGGTGGAGGAACAACAACTTCAACCGACAATTGTTGGTCAAGAAACAATGCTTGATAACGCATGGAATCATCTAATGGAAGATGGAGTTGGTATTATGGGATTGTATGGTATGGGAGGTGTTGGGAAGACGACTCTTCTCACCCAGATTAACAATAAGTTCAGTAAGTATATGTGTGGCTTTGACAGCGTGATTTGGGTTGTGGTGTCTAAAGAGGTGAATGTAGAGAATATTCTAGATGAAATCGCTCAGAAAGTTCATATTAGTGGAGAGAAGTGGGACACAAAATATAAATACCAAAAGGGCGTTTATTTATACAATTTCTTAAGGAAAATGAGATTTGTATTGTTTTTGGATGACATATGGGAGAAGGTTAATTTAGTTGAGATCGGAGTCCCCTTTCCAACAATAAAAAACAAATGTAAAGTGGTATTCACCACTCGGTCCTTAGATGTATGCACAAGCATGGGGGTTGAAAAACCAATGGAAGTCCAATGCCTGGCGGACAACGACGCATATGATTTGTTCCAAAAAAAGGTTGGACAAATAACACTAGGAAGCGACCCAGAGATCCGTGAACTTTCTAGAGTAGTTGCTAAAAAATGTTGTGGTTTACCATTGGCGCTCAATGTGGTAAGTGAGACCATGTCATGCAAGAGGACGGTACAAGAATGGCGTCATGCGATATATGTTTTAAATTCATATGCTGCAAAGTTTTCTGGCATGGACGATAAGATCCTTCCGCTTTTAAAGTATAGCTATGATAGTCTCAAAGGGGAGGATGTCAAAATGTGTTTGCTATATTGCGCTTTGTTTCCAGAAGATGCTAAAATAAGGAAGGAGAATCTGATAGAGTACTGGATATGCGAGGAAATTATAGATGGAAGTGAAGGTATTGATAAGGCTGAGAACCAAGGTTATGAGATAATTGGTAGTCTTGTTCGTGCATCATTGTTGATGGAAGAGGTTGAATTGGATGGAGCAAATATTGTTTGTCTGCATGATGTTGTTCGTGAAATGGCTTTATGGATCGCATCTGATTTGGGAAAACAAAATGAGGCGTTTATTGTGCGTGCAAGTGTTGGGCTACGTGAAATTCTAAAGGTTGAGAATTGGAACGTCGTGAGAAGGATGTCATTGATGAAGAATAATATTGCTCATCTTGATGGCCGTCTTGATTGTATGGAACTCACAACTTTGCTACTACAAAGCACACATTTGGAAAAGATCTCGAGTGAATTCTTCAACTCCATGCCAAAGCTAGCTGTTTTGGATCTATCAGGCAATTATTACCTCTCTGAATTGCCAAACGGAATATCAGAACTAGTTTCCTTGCAATATCTCAACTTGTCAAGTACTGGTATACGTCATTTGCCTAAGGGTCTACAAGAGTTGAAGAAACTAATTCACTTGTACTTGGAGCGAACAAGTCAGCTTGGAAGTATGGTTGGGATATCATGCCTTCATAATTTGAAAGTTTTGAAATTATCTGGTTCTAGTTATGCATGGGATCTCGACACAGTGAAGGAGTTGGAAGCCTTGGAACACTTGGAAGTTTTAACCACAACTATCGATGACTGTACTCTAGGTACGGATCAATTCTTGAGCTCTCATAGGTTGATGAGTTGCATACGGTTTCTAAAGATATCGAATAATAGTAATAGAAATAGGAACTCATCTAGAATATCACTTCCAGTAACTATGGACAGGCTTCAAGAATTTACCATTGAGCATTGCCATACCTCTGAGATAAAGATGGGAAGGATATGCAGCTTCTCCAGCCTCATCGAAGTGAATCTAAGCAATTGTAGACGCCTGAGGGAATTGACATTTCTGATGTTCGCTCCAAATCTTAAACGGCTTCATGTTGTCTCTTCAAATCAACTAGAAGATATAATAAACAAAGAGAAAGCTCATGATGGTGAAAAATCAGGGATTGTTCCTTTCCCAAAGCTGAATGAACTTCACTTATATAATCTACGGGAGCTGAAGAATATCTATTGGAGTCCTCTACCATTTCCATGTCTAGAGAAAATCAATGTAATGGGCTGTCCAAATCTGAAAAAGCTTCCACTCGATTCTAAAAGTGGAAAGCATGGTGGAAATGGACTCATCATAACACACCGTGAGATGGAATGGATTACACGTGTGGAATGGGAGGACGAAGCTACTAAAACCCGCTTCTTAGCCAACAGGTCTAGTTTCTCATCTTCTCTTATTTGTTTTTCAAATGATTTAGTTTCTCGTGATATGAACTGCTTCCATCTTTAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MGISFSIPFDPCVNKVSQWLDMKVSYTHNLEKNLVALETTMEELKAKRDDLLRKLKREEDRGLQTLGEIKVWLNRVETIESRVNDLLNARNAELQRLCLCGFCSKSLTTSYRYGKSVFLKLREVEKLERRVFEVISDQASTSEVEEQQLQPTIVGQETMLDNAWNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWVVVSKEVNVENILDEIAQKVHISGEKWDTKYKYQKGVYLYNFLRKMRFVLFLDDIWEKVNLVEIGVPFPTIKNKCKVVFTTRSLDVCTSMGVEKPMEVQCLADNDAYDLFQKKVGQITLGSDPEIRELSRVVAKKCCGLPLALNVVSETMSCKRTVQEWRHAIYVLNSYAAKFSGMDDKILPLLKYSYDSLKGEDVKMCLLYCALFPEDAKIRKENLIEYWICEEIIDGSEGIDKAENQGYEIIGSLVRASLLMEEVELDGANIVCLHDVVREMALWIASDLGKQNEAFIVRASVGLREILKVENWNVVRRMSLMKNNIAHLDGRLDCMELTTLLLQSTHLEKISSEFFNSMPKLAVLDLSGNYYLSELPNGISELVSLQYLNLSSTGIRHLPKGLQELKKLIHLYLERTSQLGSMVGISCLHNLKVLKLSGSSYAWDLDTVKELEALEHLEVLTTTIDDCTLGTDQFLSSHRLMSCIRFLKISNNSNRNRNSSRISLPVTMDRLQEFTIEHCHTSEIKMGRICSFSSLIEVNLSNCRRLRELTFLMFAPNLKRLHVVSSNQLEDIINKEKAHDGEKSGIVPFPKLNELHLYNLRELKNIYWSPLPFPCLEKINVMGCPNLKKLPLDSKSGKHGGNGLIITHREMEWITRVEWEDEATKTRFLANRSSFSSSLICFSNDLVSRDMNCFHL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-896 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FSIPFDPCVNKVSQWLDMKVSYTHNLEKNLVALETTMEELKAKRDDLLRKLKREEDRGLQTLGEIKVWLNRVETIESRVNDLLNARNAELQRLCLCGFCSKSLTTSYRYGKSVFLKLREVEKLERRVFEVISDQASTSEVEEQQLQPTIVGQETMLDNAWNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWVVVSKEVNVENILDEIAQKVHISGEKWDTKYKYQKGVYLYNFLRKMRFVLFLDDIWEKVNLVEIGVPFPTIKNKCKVVFTTRSLDVCTSMGVEKPMEVQCLADNDAYDLFQKKVGQITLGSDPEIRELSRVVAKKCCGLPLALNVVSETMSCKRTVQEWRHAIYVLNSYAAKFSGMDDKILPLLKYSYDSLKGEDVKMCLLYCALFPEDAKIRKENLIEYWICEEIIDGSEGIDKAENQGYEIIGSLVRASLLMEEVELDGANIVCLHDVVREMALWIASDLGKQNEAFIVRASVGLREILKVENWNVVRRMSLMKNNIAHLDGRLDCMELTTLLLQSTHLEKISSEFFNSMPKLAVLDLSGNYYLSELPNGISELVSLQYLNLSSTGIRHLPKGLQELKKLIHLYLERTSQLGSMVGISCLHNLKVLKLSGSSYAWDLDTVKELEALEHLEVLTTTIDDCTLGTDQFLSSHRLMSCIRFLKISNNSNRNRNSSRISLPVTMDRLQEFTIEHCHTSEIKMGRICSFSSLIEVNLSNCRRLRELTFLMFAPNLKRLHVVSSNQLEDIINKEKAHDGEKSGIVPFPKLNELHLYNLRELKNIYWSPLPFPCLEKINVMGCPNLKKLPLDSKSGKHGGNGLIITHREMEWITRVEWEDEATKTRFLANRSSFSSSLICFSNDLVSRDMNCF

HMMPanther: PTHR23155:SF108
5-896 PTHR23155:SF108,SUBFAMILY NOT NAMED

FSIPFDPCVNKVSQWLDMKVSYTHNLEKNLVALETTMEELKAKRDDLLRKLKREEDRGLQTLGEIKVWLNRVETIESRVNDLLNARNAELQRLCLCGFCSKSLTTSYRYGKSVFLKLREVEKLERRVFEVISDQASTSEVEEQQLQPTIVGQETMLDNAWNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWVVVSKEVNVENILDEIAQKVHISGEKWDTKYKYQKGVYLYNFLRKMRFVLFLDDIWEKVNLVEIGVPFPTIKNKCKVVFTTRSLDVCTSMGVEKPMEVQCLADNDAYDLFQKKVGQITLGSDPEIRELSRVVAKKCCGLPLALNVVSETMSCKRTVQEWRHAIYVLNSYAAKFSGMDDKILPLLKYSYDSLKGEDVKMCLLYCALFPEDAKIRKENLIEYWICEEIIDGSEGIDKAENQGYEIIGSLVRASLLMEEVELDGANIVCLHDVVREMALWIASDLGKQNEAFIVRASVGLREILKVENWNVVRRMSLMKNNIAHLDGRLDCMELTTLLLQSTHLEKISSEFFNSMPKLAVLDLSGNYYLSELPNGISELVSLQYLNLSSTGIRHLPKGLQELKKLIHLYLERTSQLGSMVGISCLHNLKVLKLSGSSYAWDLDTVKELEALEHLEVLTTTIDDCTLGTDQFLSSHRLMSCIRFLKISNNSNRNRNSSRISLPVTMDRLQEFTIEHCHTSEIKMGRICSFSSLIEVNLSNCRRLRELTFLMFAPNLKRLHVVSSNQLEDIINKEKAHDGEKSGIVPFPKLNELHLYNLRELKNIYWSPLPFPCLEKINVMGCPNLKKLPLDSKSGKHGGNGLIITHREMEWITRVEWEDEATKTRFLANRSSFSSSLICFSNDLVSRDMNCF

superfamily: SSF52540
132-380 SSF52540

FEVISDQASTSEVEEQQLQPTIVGQETMLDNAWNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWVVVSKEVNVENILDEIAQKVHISGEKWDTKYKYQKGVYLYNFLRKMRFVLFLDDIWEKVNLVEIGVPFPTIKNKCKVVFTTRSLDVCTSMGVEKPMEVQCLADNDAYDLFQKKVGQITLGSDPEIRELSRVVAKKCCGLPLALNVVSETMSCKRTVQEWRHAIYVLNSYAAK

HMMPfam: PF00931
IPR002182
156-436 NB-ARC,NBS
NB-ARC

QETMLDNAWNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWVVVSKEVNVENILDEIAQKVHISGEKWDTKYKYQKGVYLYNFLRKMRFVLFLDDIWEKVNLVEIGVPFPTIKNKCKVVFTTRSLDVCTSMGVEKPMEVQCLADNDAYDLFQKKVGQITLGSDPEIRELSRVVAKKCCGLPLALNVVSETMSCKRTVQEWRHAIYVLNSYAAKFSGMDDKILPLLKYSYDSLKGEDVKMCLLYCALFPEDAKIRKENLIEYWICEEIID

Gene3D: G3DSA:3.40.50.300
164-295 G3DSA:3.40.50.300

WNHLMEDGVGIMGLYGMGGVGKTTLLTQINNKFSKYMCGFDSVIWVVVSKEVNVENILDEIAQKVHISGEKWDTKYKYQKGVYLYNFLRKMRFVLFLDDIWEKVNLVEIGVPFPTIKNKCKVVFTTRSLDVC

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

IMGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

FLRKMRFVLFLDDIW

FPrintScan: PR00364
IPR000767
344-358 DISEASERSIST
Disease resistance protein

CCGLPLALNVVSETM

superfamily: SSF52058
474-833 SSF52058,LRR

CLHDVVREMALWIASDLGKQNEAFIVRASVGLREILKVENWNVVRRMSLMKNNIAHLDGRLDCMELTTLLLQSTHLEKISSEFFNSMPKLAVLDLSGNYYLSELPNGISELVSLQYLNLSSTGIRHLPKGLQELKKLIHLYLERTSQLGSMVGISCLHNLKVLKLSGSSYAWDLDTVKELEALEHLEVLTTTIDDCTLGTDQFLSSHRLMSCIRFLKISNNSNRNRNSSRISLPVTMDRLQEFTIEHCHTSEIKMGRICSFSSLIEVNLSNCRRLRELTFLMFAPNLKRLHVVSSNQLEDIINKEKAHDGEKSGIVPFPKLNELHLYNLRELKNIYWSPLPFPCLEKINVMGCPNLKKLP

Gene3D: G3DSA:3.80.10.10
514-662 G3DSA:3.80.10.10

WNVVRRMSLMKNNIAHLDGRLDCMELTTLLLQSTHLEKISSEFFNSMPKLAVLDLSGNYYLSELPNGISELVSLQYLNLSSTGIRHLPKGLQELKKLIHLYLERTSQLGSMVGISCLHNLKVLKLSGSSYAWDLDTVKELEALEHLEVL

HMMPfam: PF13855
539-596 LRR_8,Leucine rich repeat

LTTLLLQSTHLEKISSEFFNSMPKLAVLDLSGNYYLSELPNGISELVSLQYLNLSSTG

FPrintScan: PR00364
IPR000767
558-574 DISEASERSIST
Disease resistance protein

NSMPKLAVLDLSGNYYL

Gene3D: G3DSA:3.80.10.10
711-831 G3DSA:3.80.10.10

DRLQEFTIEHCHTSEIKMGRICSFSSLIEVNLSNCRRLRELTFLMFAPNLKRLHVVSSNQLEDIINKEKAHDGEKSGIVPFPKLNELHLYNLRELKNIYWSPLPFPCLEKINVMGCPNLKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox