PRGDB00046957 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18391374 (NM_101101)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G12290) mRNA, complete cds.

DNA Sequence

ATGGGTGGTTGTGTCTCTGTCCAAGTATCATGCGATCAATTGTTGAACCATCTAGGTAGATGCTTTTGCAGAAAACTTTATTATATTCAAAATATAAAGGAGAATCTCACTTCTTTGGAGGAAGCCATGGAAGATCTCAAGGCATTGAGAGATGATCTGCTACGTAAGGTGCAGACAGCAGAAGAAGGAGGTCTACAAAGGCTTCATCAAATCAAGGTATGGCTTAAGAGAGTCAAGACTATCGAATCCCAATTCAATGATCTAGATAGTAGTAGAACTGTTGAACTTCAAAGGTTGTGTTGTTGTGGTGTTGGCTCGAGAAACTTAAGATTGAGCTATGACTATGGAAGAAGGGTCTTCTTGATGTTGAATATAGTTGAAGACTTAAAATCTAAAGGGATTTTTGAAGAGGTGGCTCATCCAGCTACGAGAGCTGTGGGGGAGGAAAGGCCTCTACAACCAACGATTGTTGGTCAGGAAACAATTTTAGAAAAGGCATGGGACCACCTCATGGATGATGGAACTAAGATTATGGGTCTCTATGGCATGGGTGGAGTAGGAAAAACAACCCTTCTCACTCAGATCAACAATAGGTTTTGTGACACCGATGATGGCGTTGAAATTGTCATTTGGGTTGTGGTATCTGGTGATCTACAAATCCACAAGATACAAAAAGAGATTGGCGAAAAAATAGGATTTATAGGCGTGGAATGGAACCAGAAAAGTGAAAACCAAAAGGCAGTCGATATACTCAATTTTCTAAGCAAAAAGAGATTTGTGTTGCTTTTGGATGACATATGGAAGAGGGTGGAACTAACTGAGATTGGAATCCCGAATCCAACAAGTGAAAACGGATGCAAAATAGCATTCACCACTCGCTGTCAAAGTGTTTGTGCGAGCATGGGAGTTCATGATCCGATGGAAGTCCGGTGTTTAGGTGCAGATGATGCGTGGGATTTGTTCAAGAAAAAAGTTGGAGATATCACATTAAGCAGCCACCCTGACATTCCCGAAATCGCAAGAAAAGTTGCTCAAGCATGTTGTGGTTTGCCGCTAGCGCTAAACGTCATTGGAGAGACAATGGCATGTAAGAAGACAACGCAAGAATGGGATCGTGCAGTAGATGTCTCAACAACATATGCTGCAAATTTTGGTGCTGTAAAGGAGAGGATTCTTCCTATTTTGAAGTACAGCTATGATAATCTGGAAAGTGAGAGTGTTAAAACTTGTTTCCTATATTGCTCTCTGTTTCCCGAAGATGATTTAATAGAAAAAGAGAGGCTGATAGATTATTGGATATGCGAGGGATTCATTGATGGAGATGAAAATAAAAAAGGAGCGGTGGGTGAAGGCTATGAGATACTCGGTACTCTTGTTTGTGCCTCTTTGTTGGTGGAGGGAGGAAAGTTCAACAATAAGTCATATGTGAAAATGCATGATGTGGTACGTGAGATGGCCCTGTGGATAGCATCTGACCTAAGGAAGCATAAAGATAATTGTATTGTTCGAGCCGGTTTTAGGTTAAACGAAATACCAAAGGTCAAGGATTGGAAAGTTGTGAGTAGGATGTCACTGGTGAATAACAGGATTAAAGAGATACATGGCAGTCCTGAGTGTCCTAAACTTACAACTTTGTTCCTGCAGGATAACCGCCATCTGGTAAATATCTCCGGGGAATTCTTCAGGTCTATGCCAAGGCTAGTTGTTTTGGATCTATCATGGAATGTCAATCTCAGTGGGTTACCGGATCAAATATCAGAGTTGGTTTCATTACGATATCTTGACTTGTCATATTCGAGCATAGGGAGATTGCCAGTTGGTTTATTAAAGTTGAAAAAGCTGATGCATCTGAATCTAGAGTCAATGTTGTGCCTTGAGAGTGTTTCAGGGATTGATCATTTGTCGAATCTGAAGACGGTGAGGCTACTAAATTTAAGAATGTGGCTAACTATAAGCTTACTGGAGGAGCTGGAACGTTTGGAGAATTTAGAAGTTCTAACCATAGAGATCATATCAAGTTCAGCATTGGAACAACTGTTATGCTCTCACAGGTTGGTGAGATGTCTTCAAAAGGTATCTGTTAAATACCTCGACGAAGAATCAGTCAGAATATTGACTTTGCCATCTATAGGTGATCTCCGGGAAGTCTTCATAGGGGGATGTGGAATGCGGGATATAATTATAGAAAGGAACACAAGTCTGACAAGCCCATGCTTTCCAAATCTATCCAAAGTTTTGATAACTGGTTGCAATGGTCTTAAGGATTTGACGTGGTTGTTGTTTGCTCCTAACCTCACTCATCTCAATGTTTGGAACTCACGCCAAATAGAAGAAATAATAAGCCAAGAGAAAGCTTCCACAGCTGATATTGTTCCTTTTCGGAAACTAGAATATCTGCACTTGTGGGATTTACCTGAACTGAAGAGCATATATTGGAATCCTTTGCCTTTTCCATGTCTGAATCAGATCAATGTACAAAATAAGTGTCGAAAGCTGACAAAGCTTCCATTGGATTCTCAAAGTTGCATTGTGGCGGGTGAAGAACTTGTCATACAATATGGAGATGAAGAATGGAAGGAAAGGGTCGAGTGGGAGGACAAAGCCACAAGACTCCGTTTCTTACCGTCATGCAAGTTGGTTTTGTGTAATCGATAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MGGCVSVQVSCDQLLNHLGRCFCRKLYYIQNIKENLTSLEEAMEDLKALRDDLLRKVQTAEEGGLQRLHQIKVWLKRVKTIESQFNDLDSSRTVELQRLCCCGVGSRNLRLSYDYGRRVFLMLNIVEDLKSKGIFEEVAHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDGTKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGEKIGFIGVEWNQKSENQKAVDILNFLSKKRFVLLLDDIWKRVELTEIGIPNPTSENGCKIAFTTRCQSVCASMGVHDPMEVRCLGADDAWDLFKKKVGDITLSSHPDIPEIARKVAQACCGLPLALNVIGETMACKKTTQEWDRAVDVSTTYAANFGAVKERILPILKYSYDNLESESVKTCFLYCSLFPEDDLIEKERLIDYWICEGFIDGDENKKGAVGEGYEILGTLVCASLLVEGGKFNNKSYVKMHDVVREMALWIASDLRKHKDNCIVRAGFRLNEIPKVKDWKVVSRMSLVNNRIKEIHGSPECPKLTTLFLQDNRHLVNISGEFFRSMPRLVVLDLSWNVNLSGLPDQISELVSLRYLDLSYSSIGRLPVGLLKLKKLMHLNLESMLCLESVSGIDHLSNLKTVRLLNLRMWLTISLLEELERLENLEVLTIEIISSSALEQLLCSHRLVRCLQKVSVKYLDEESVRILTLPSIGDLREVFIGGCGMRDIIIERNTSLTSPCFPNLSKVLITGCNGLKDLTWLLFAPNLTHLNVWNSRQIEEIISQEKASTADIVPFRKLEYLHLWDLPELKSIYWNPLPFPCLNQINVQNKCRKLTKLPLDSQSCIVAGEELVIQYGDEEWKERVEWEDKATRLRFLPSCKLVLCNR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF111
7-884 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VQVSCDQLLNHLGRCFCRKLYYIQNIKENLTSLEEAMEDLKALRDDLLRKVQTAEEGGLQRLHQIKVWLKRVKTIESQFNDLDSSRTVELQRLCCCGVGSRNLRLSYDYGRRVFLMLNIVEDLKSKGIFEEVAHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDGTKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGEKIGFIGVEWNQKSENQKAVDILNFLSKKRFVLLLDDIWKRVELTEIGIPNPTSENGCKIAFTTRCQSVCASMGVHDPMEVRCLGADDAWDLFKKKVGDITLSSHPDIPEIARKVAQACCGLPLALNVIGETMACKKTTQEWDRAVDVSTTYAANFGAVKERILPILKYSYDNLESESVKTCFLYCSLFPEDDLIEKERLIDYWICEGFIDGDENKKGAVGEGYEILGTLVCASLLVEGGKFNNKSYVKMHDVVREMALWIASDLRKHKDNCIVRAGFRLNEIPKVKDWKVVSRMSLVNNRIKEIHGSPECPKLTTLFLQDNRHLVNISGEFFRSMPRLVVLDLSWNVNLSGLPDQISELVSLRYLDLSYSSIGRLPVGLLKLKKLMHLNLESMLCLESVSGIDHLSNLKTVRLLNLRMWLTISLLEELERLENLEVLTIEIISSSALEQLLCSHRLVRCLQKVSVKYLDEESVRILTLPSIGDLREVFIGGCGMRDIIIERNTSLTSPCFPNLSKVLITGCNGLKDLTWLLFAPNLTHLNVWNSRQIEEIISQEKASTADIVPFRKLEYLHLWDLPELKSIYWNPLPFPCLNQINVQNKCRKLTKLPLDSQSCIVAGEELVIQYGDEEWKERVEWEDKATRLRFLPSCKLVLCNR

HMMPanther: PTHR23155
7-884 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VQVSCDQLLNHLGRCFCRKLYYIQNIKENLTSLEEAMEDLKALRDDLLRKVQTAEEGGLQRLHQIKVWLKRVKTIESQFNDLDSSRTVELQRLCCCGVGSRNLRLSYDYGRRVFLMLNIVEDLKSKGIFEEVAHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDGTKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGEKIGFIGVEWNQKSENQKAVDILNFLSKKRFVLLLDDIWKRVELTEIGIPNPTSENGCKIAFTTRCQSVCASMGVHDPMEVRCLGADDAWDLFKKKVGDITLSSHPDIPEIARKVAQACCGLPLALNVIGETMACKKTTQEWDRAVDVSTTYAANFGAVKERILPILKYSYDNLESESVKTCFLYCSLFPEDDLIEKERLIDYWICEGFIDGDENKKGAVGEGYEILGTLVCASLLVEGGKFNNKSYVKMHDVVREMALWIASDLRKHKDNCIVRAGFRLNEIPKVKDWKVVSRMSLVNNRIKEIHGSPECPKLTTLFLQDNRHLVNISGEFFRSMPRLVVLDLSWNVNLSGLPDQISELVSLRYLDLSYSSIGRLPVGLLKLKKLMHLNLESMLCLESVSGIDHLSNLKTVRLLNLRMWLTISLLEELERLENLEVLTIEIISSSALEQLLCSHRLVRCLQKVSVKYLDEESVRILTLPSIGDLREVFIGGCGMRDIIIERNTSLTSPCFPNLSKVLITGCNGLKDLTWLLFAPNLTHLNVWNSRQIEEIISQEKASTADIVPFRKLEYLHLWDLPELKSIYWNPLPFPCLNQINVQNKCRKLTKLPLDSQSCIVAGEELVIQYGDEEWKERVEWEDKATRLRFLPSCKLVLCNR

Coil: coil
29-64 coiled-coil

IQNIKENLTSLEEAMEDLKALRDDLLRKVQTAEEGG

Seg: seg
45-56 seg

DLKALRDDLLRK

superfamily: SSF52540
139-372 P-loop containing nucleoside triphosphate hydrolases

AHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDGTKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGEKIGFIGVEWNQKSENQKAVDILNFLSKKRFVLLLDDIWKRVELTEIGIPNPTSENGCKIAFTTRCQSVCASMGVHDPMEVRCLGADDAWDLFKKKVGDITLSSHPDIPEIARKVAQACCGLPLALNVIGETMACKKTTQEWDR

HMMPfam: PF00931
IPR002182
160-439 NB-ARC,NBS
NB-ARC

ETILEKAWDHLMDDGTKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGEKIGFIGVEWNQKSENQKAVDILNFLSKKRFVLLLDDIWKRVELTEIGIPNPTSENGCKIAFTTRCQSVCASMGVHDPMEVRCLGADDAWDLFKKKVGDITLSSHPDIPEIARKVAQACCGLPLALNVIGETMACKKTTQEWDRAVDVSTTYAANFGAVKERILPILKYSYDNLESESVKTCFLYCSLFPEDDLIEKERLIDYWICEGFID

Gene3D: G3DSA:3.40.50.300
170-268 no description

LMDDGTKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGEKIGFIGVEWNQKSENQKAVDILNFLSKKRFVLLLDDIWK

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

IMGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

FLSKKRFVLLLDDIW

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

CCGLPLALNVIGETM

superfamily: SSF52058
477-836 L domain-like,LRR

KMHDVVREMALWIASDLRKHKDNCIVRAGFRLNEIPKVKDWKVVSRMSLVNNRIKEIHGSPECPKLTTLFLQDNRHLVNISGEFFRSMPRLVVLDLSWNVNLSGLPDQISELVSLRYLDLSYSSIGRLPVGLLKLKKLMHLNLESMLCLESVSGIDHLSNLKTVRLLNLRMWLTISLLEELERLENLEVLTIEIISSSALEQLLCSHRLVRCLQKVSVKYLDEESVRILTLPSIGDLREVFIGGCGMRDIIIERNTSLTSPCFPNLSKVLITGCNGLKDLTWLLFAPNLTHLNVWNSRQIEEIISQEKASTADIVPFRKLEYLHLWDLPELKSIYWNPLPFPCLNQINVQNKCRKLTKLP

Gene3D: G3DSA:3.80.10.10
507-826 no description

RLNEIPKVKDWKVVSRMSLVNNRIKEIHGSPECPKLTTLFLQDNRHLVNISGEFFRSMPRLVVLDLSWNVNLSGLPDQISELVSLRYLDLSYSSIGRLPVGLLKLKKLMHLNLESMLCLESVSGIDHLSNLKTVRLLNLRMWLTISLLEELERLENLEVLTIEIISSSALEQLLCSHRLVRCLQKVSVKYLDEESVRILTLPSIGDLREVFIGGCGMRDIIIERNTSLTSPCFPNLSKVLITGCNGLKDLTWLLFAPNLTHLNVWNSRQIEEIISQEKASTADIVPFRKLEYLHLWDLPELKSIYWNPLPFPCLNQINVQ

HMMPfam: PF13855
540-601 LRR_8,Leucine rich repeat

PKLTTLFLQDNRHLVNISGEFFRSMPRLVVLDLSWNVNLSGLPDQISELVSLRYLDLSYSSI

FPrintScan: PR00364
IPR000767
562-578 DISEASERSIST
Disease resistance protein

RSMPRLVVLDLSWNVNL

Seg: seg
608-619 seg

LLKLKKLMHLNL

Seg: seg
653-666 seg

LLEELERLENLEVL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox