PRGDB00046958 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18391373 (NM_101100)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G12280) mRNA, complete cds.

DNA Sequence

ATGGGAGCTTGTTTAACACTCTCGTTCTCTTGTGATGAAGTTGTGAATCAAATCTCTCAAGGTTTATGCATCAACGTGGGTTATATTTGCGAGCTCTCCAAGAATGTAGTGGCTATGAAGAAAGACATGGAAGTGCTGAAGAAAAAGCGAGATGATGTGAAAAGAAGGGTAGATATAGAAGAGTTCACAAGGCGTCGTGAAAGGCTTTCTCAAGTCCAAGGATGGCTTACGAATGTCTCGACCGTCGAGAATAAATTCAATGAACTGCTTACCACTAATGACGCTGAGCTTCAAAGGTTGTGTCTCTTTGGATTTTGCTCTAAAAATGTGAAAATGAGCTATCTTTATGGGAAAAGGGTTGTCCTGATGTTGAAGGAGATTGAGAGTCTTAGTTCTCAAGGAGATTTTGATACTGTGACTTTAGCCACTCCAATAGCTAGGATTGAAGAGATGCCTATTCAACCTACAATCGTAGGTCAGGAAACAATGCTCGAAAGGGTATGGACCCGTCTCACAGAAGACGGAGACGAGATTGTGGGTCTTTATGGCATGGGTGGAGTAGGCAAAACCACCCTTCTCACACGAATCAACAACAAGTTTTCTGAAAAATGTAGCGGGTTTGGGGTTGTGATATGGGTGGTGGTGTCTAAGAGTCCAGATATCCATAGGATTCAAGGAGACATCGGGAAGAGACTAGACCTTGGAGGCGAAGAGTGGGATAATGTAAATGAAAACCAGAGAGCCCTTGACATATACAATGTCCTTGGGAAACAAAAATTTGTGTTGTTGTTGGATGATATATGGGAGAAAGTGAATTTAGAAGTGCTTGGAGTCCCTTATCCAAGCAGACAAAATGGATGCAAAGTAGTATTCACCACTCGTTCTAGAGATGTTTGTGGGCGTATGCGGGTTGATGACCCGATGGAAGTCAGTTGCCTAGAACCCAACGAAGCCTGGGAATTGTTCCAAATGAAAGTTGGAGAAAACACATTGAAAGGCCATCCAGACATTCCTGAACTTGCAAGAAAAGTTGCTGGAAAATGTTGTGGCCTACCATTGGCACTTAATGTCATTGGCGAGACCATGGCATGCAAAAGGATGGTACAAGAATGGCGTAACGCAATTGACGTTTTGAGCTCATATGCTGCAGAATTCCCTGGTATGGAACAAATTCTTCCTATTCTAAAGTATAGCTATGATAATTTAAACAAGGAGCAGGTGAAACCATGTTTCCTATATTGCTCTCTGTTTCCTGAAGATTATCGTATGGAAAAAGAGAGGTTGATAGACTATTGGATATGTGAGGGATTCATAGATGAAAATGAAAGTAGAGAAAGAGCATTAAGCCAAGGTTATGAGATCATTGGTATCCTTGTCCGAGCATGTTTGTTGTTGGAGGAAGCTATCAATAAAGAACAAGTTAAAATGCATGATGTGGTTCGGGAGATGGCTCTATGGATTGCATCTGATCTTGGGGAACATAAAGAAAGATGTATTGTGCAAGTCGGTGTTGGATTACGTGAGGTACCGAAAGTCAAGAACTGGAGTTCTGTGAGAAGGATGTCGCTGATGGAAAATGAGATTGAAATTTTATCTGGCAGTCCCGAATGCCTGGAACTTACAACTCTGTTCCTTCAGAAAAATGATTCATTGCTACATATCTCGGATGAATTCTTCCGGTGTATCCCAATGCTAGTTGTTTTGGATCTATCAGGGAATTCAAGTCTCCGGAAATTGCCTAACCAAATATCAAAGTTAGTCTCCTTGCGTTATCTTGACTTGTCGTGGACATACATTAAGCGGCTACCTGTCGGTCTACAAGAGTTGAAAAAGCTCAGATATTTGAGATTGGATTACATGAAGAGACTTAAGAGTATTTCAGGGATATCAAATATATCAAGTTTGAGGAAATTGCAACTTTTACAGTCTAAAATGTCGCTAGACATGAGCTTAGTGGAGGAGTTGCAGCTATTAGAACATTTAGAAGTTCTAAACATAAGTATCAAGTCAAGCTTGGTAGTGGAGAAGTTGTTAAATGCTCCCAGGTTGGTGAAATGTCTTCAAATCTTAGTACTTAGAGGAGTTCAGGAAGAATCATCCGGAGTATTGACTTTGCCAGATATGGATAATCTCAATAAAGTCATCATAAGGAAGTGTGGAATGTGTGAGATAAAGATAGAGAGGAAAACTTTATCATTATCATCGAACAGAAGTCCCAAAACTCAATTCCTCCATAACCTCTCCACTGTGCATATAAGTAGCTGTGATGGTCTGAAGGATTTGACGTGGTTGTTGTTCGCTCCTAACCTCACTAGTCTCGAGGTTCTGGACTCGGAACTAGTAGAAGGAATAATAAACCAAGAGAAAGCTATGACTATGAGTGGTATCATTCCTTTCCAGAAACTAGAGAGTCTACGCCTACACAATCTAGCGATGTTGAGGAGCATCTACTGGCAACCTCTGTCTTTTCCATGTCTGAAGACAATTCACATAACGAAGTGTCCTGAGCTGAGAAAGCTTCCATTGGATTCTGAAATTGCCATAAGGGATGAAGAACTTGTCATTAAGTACCAAGAGGAAGAATGGCTTGAAAGGGTTGAATGGGACAACGAAGCCACAAGACTCCGTTTCTTACCTTTTTTCAAGTTCTTTGGACCTGAATGGCAAGTTAGTTATGTGCGGTAG


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MGACLTLSFSCDEVVNQISQGLCINVGYICELSKNVVAMKKDMEVLKKKRDDVKRRVDIEEFTRRRERLSQVQGWLTNVSTVENKFNELLTTNDAELQRLCLFGFCSKNVKMSYLYGKRVVLMLKEIESLSSQGDFDTVTLATPIARIEEMPIQPTIVGQETMLERVWTRLTEDGDEIVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDPMEVSCLEPNEAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAEFPGMEQILPILKYSYDNLNKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDENESRERALSQGYEIIGILVRACLLLEEAINKEQVKMHDVVREMALWIASDLGEHKERCIVQVGVGLREVPKVKNWSSVRRMSLMENEIEILSGSPECLELTTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMSLDMSLVEELQLLEHLEVLNISIKSSLVVEKLLNAPRLVKCLQILVLRGVQEESSGVLTLPDMDNLNKVIIRKCGMCEIKIERKTLSLSSNRSPKTQFLHNLSTVHISSCDGLKDLTWLLFAPNLTSLEVLDSELVEGIINQEKAMTMSGIIPFQKLESLRLHNLAMLRSIYWQPLSFPCLKTIHITKCPELRKLPLDSEIAIRDEELVIKYQEEEWLERVEWDNEATRLRFLPFFKFFGPEWQVSYVR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
7-881 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSFSCDEVVNQISQGLCINVGYICELSKNVVAMKKDMEVLKKKRDDVKRRVDIEEFTRRRERLSQVQGWLTNVSTVENKFNELLTTNDAELQRLCLFGFCSKNVKMSYLYGKRVVLMLKEIESLSSQGDFDTVTLATPIARIEEMPIQPTIVGQETMLERVWTRLTEDGDEIVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDPMEVSCLEPNEAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAEFPGMEQILPILKYSYDNLNKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDENESRERALSQGYEIIGILVRACLLLEEAINKEQVKMHDVVREMALWIASDLGEHKERCIVQVGVGLREVPKVKNWSSVRRMSLMENEIEILSGSPECLELTTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMSLDMSLVEELQLLEHLEVLNISIKSSLVVEKLLNAPRLVKCLQILVLRGVQEESSGVLTLPDMDNLNKVIIRKCGMCEIKIERKTLSLSSNRSPKTQFLHNLSTVHISSCDGLKDLTWLLFAPNLTSLEVLDSELVEGIINQEKAMTMSGIIPFQKLESLRLHNLAMLRSIYWQPLSFPCLKTIHITKCPELRKLPLDSEIAIRDEELVIKYQEEEWLERVEWDNEATRLRFLPFF

HMMPanther: PTHR23155:SF112
7-881 PTHR23155:SF112,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LSFSCDEVVNQISQGLCINVGYICELSKNVVAMKKDMEVLKKKRDDVKRRVDIEEFTRRRERLSQVQGWLTNVSTVENKFNELLTTNDAELQRLCLFGFCSKNVKMSYLYGKRVVLMLKEIESLSSQGDFDTVTLATPIARIEEMPIQPTIVGQETMLERVWTRLTEDGDEIVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDPMEVSCLEPNEAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAEFPGMEQILPILKYSYDNLNKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDENESRERALSQGYEIIGILVRACLLLEEAINKEQVKMHDVVREMALWIASDLGEHKERCIVQVGVGLREVPKVKNWSSVRRMSLMENEIEILSGSPECLELTTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMSLDMSLVEELQLLEHLEVLNISIKSSLVVEKLLNAPRLVKCLQILVLRGVQEESSGVLTLPDMDNLNKVIIRKCGMCEIKIERKTLSLSSNRSPKTQFLHNLSTVHISSCDGLKDLTWLLFAPNLTSLEVLDSELVEGIINQEKAMTMSGIIPFQKLESLRLHNLAMLRSIYWQPLSFPCLKTIHITKCPELRKLPLDSEIAIRDEELVIKYQEEEWLERVEWDNEATRLRFLPFF

superfamily: SSF52540
140-384 SSF52540

TLATPIARIEEMPIQPTIVGQETMLERVWTRLTEDGDEIVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDPMEVSCLEPNEAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAE

HMMPfam: PF00931
IPR002182
160-441 NB-ARC,NBS
NB-ARC

QETMLERVWTRLTEDGDEIVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDPMEVSCLEPNEAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAEFPGMEQILPILKYSYDNLNKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDEN

Gene3D: G3DSA:3.40.50.300
168-298 G3DSA:3.40.50.300

WTRLTEDGDEIVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDV

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

IVGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
254-268 DISEASERSIST
Disease resistance protein

VLGKQKFVLLLDDIW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CCGLPLALNVIGETM

superfamily: SSF52058
475-859 SSF52058,LRR

KMHDVVREMALWIASDLGEHKERCIVQVGVGLREVPKVKNWSSVRRMSLMENEIEILSGSPECLELTTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMSLDMSLVEELQLLEHLEVLNISIKSSLVVEKLLNAPRLVKCLQILVLRGVQEESSGVLTLPDMDNLNKVIIRKCGMCEIKIERKTLSLSSNRSPKTQFLHNLSTVHISSCDGLKDLTWLLFAPNLTSLEVLDSELVEGIINQEKAMTMSGIIPFQKLESLRLHNLAMLRSIYWQPLSFPCLKTIHITKCPELRKLPLDSEIAIRDEELVIKYQE

Gene3D: G3DSA:3.80.10.10
516-719 G3DSA:3.80.10.10

SSVRRMSLMENEIEILSGSPECLELTTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMSLDMSLVEELQLLEHLEVLNISIKSSLVVEKLLNAPRLVKCLQILVLRGVQEESSGVLTLPDMDNLNKVIIRKC

HMMPfam: PF13855
540-598 LRR_8,Leucine rich repeat

LTTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTY

FPrintScan: PR00364
IPR000767
560-576 DISEASERSIST
Disease resistance protein

RCIPMLVVLDLSGNSSL

Gene3D: G3DSA:3.80.10.10
730-839 G3DSA:3.80.10.10

TLSLSSNRSPKTQFLHNLSTVHISSCDGLKDLTWLLFAPNLTSLEVLDSELVEGIINQEKAMTMSGIIPFQKLESLRLHNLAMLRSIYWQPLSFPCLKTIHITKCPELRK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox