PRGDB00046960 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18418587 (NM_121840)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G18350) mRNA, complete cds.

DNA Sequence

ATGCAACCTAATCGAGCCTCGTCGTCTCTTTCATCTACTCCAACCCGAACCTGGACACACCACGTGTTCCTGAGCTTCCGCGGGGAAGACGTACGCAAAGGTTTTCTGAGTCATATTCAGAAGGAGTTCGAACGCAAAGGAATTTTTCCATTCGTTGATACTAAGATGAAGAGAGGTAGCTCGATCGGTCCTGTACTCTCTGATGCAATTATAGTATCAAAGATTGCGATTGTCTTGCTCTCAAAGAATTACGCTTCGTCGACCTGGTGCCTCAACGAATTGGTGAATATTATGAAGTGCAGGGAAGAGTTTGGTCAAACTGTGATGACCGTTTTCTATGAAGTGGATCCATCTGATGTGAGAAAGCAGACCGGAGATTTCGGGATAGCCTTTGAGACAACCTGTGTGGGCAAAACGGAAGAGGTGAAGCAGAGTTGGAGGCAAGCGTTGATAGACGTCTCGAATATAGTCGGAGAGGTTTATCGCATATGGAGCAAAGAGTCAGACTTGATTGACAAAATTGCAGAAGATGTATTGGACGAGTTGAACTATACGATGTCGAGAGATTTTGATGGCTATGTTGGAATCGGACGTCATATGAGAAAGATGAAATCCTTGTTATGCCTAGAGTCTGGTGATGTGAGAATGATAGGGATAGTGGGTCCTCCTGGGATTGGGAAGACCACCATTGCAAGAGCTTTACGTGATCAAATCTCTGAAAATTTTCAGTTGACTGCGTTTATAGACGATATCAGACTAACCTACCCGAGACGTTGCTACGGTGAGAGTGGTCTGAAACCGCCAACTGCGTTCATGAATGATGACCGAAGGAAGATTGTCTTACAAACGAACTTTTTGTCTGAAATATTAAACCAAAAAGATATCGTAATTCATAATCTAAATGCGGCGCCGAATTGGCTCAAAGACCGAAAAGTTCTTGTCATTCTTGATGACGTGGATCATTTAGAGCAACTAGATGCAATGGCGAAAGAAACTGGGTGGTTCGGCTATGGGAGTAGGATTATCATCACAACACAAGATCGAAAACTTTTGAAGGCACATAATATCGACTATATCTACGAGGTGGGACTTCCACGTAAGGATGATGCTCTACAGATCTTCTGTCTTTCTGCTTTTGGTCAAAACTTCCCACATGATGATTTTCAGTACCTTGCTTGCGAAGTTACACAACTTGCGGGTGAACTTCCTCTTGGTCTGAAAGTTTTGGGATCTTATCTGAAAGGAATGTCCCTGGAGGAGTGGAAAAATGCACTACCACGGTTAAAGACTTGCCTTGACGGTGACATTGAGAAAACTCTAAGATATAGCTACGATGCCTTAAGCCGTAAAGATCAAGCTCTCTTTCTGCACATAGCATGTTTGTTTCGTGGTTATGAAGTCGGTCATGTGAAACAGTGGCTTGGTAAGAGTGATTTGGATGTCGACCATGGGCTTGATGTTCTAAGACAGAAATCACTCATATCTATCGATATGGGTTTCCTAAATATGCATTCTTTGCTGCAACAACTGGGTGTCGAAATTGTTCGTAACCAATCTAGTCAAGAGCCTAGAGAACGTCAGTTTTTAGTAGATGTTAACGACATTTCTGATGTTTTCACCTACAATACCGCGGGCACTAAGTCTATTCTAGGCATACGTCTCAACGTCCCGGAGATAGAGGAAAAAATAGTTATTGATGAACTGGTATTTGATGGGATGACTAATCTCCAATTTTTATTTGTTAATGAGGGTTTTGGGGATAAGTTGAGTTTACCACGAGGCCTGAATTGTCTACCCGGTAAGCTCAGAGTATTGCATTGGAACTATTGTCCGTTGAGATTGTGGCCCTCTAAATTCTCCGCAAATTTTCTTGTTGAGCTTGTCATGCGGGGGAACAACTTTGAGAAACTATGGGAAAAAATCCTGCCGCTAAAAAGTCTCAAGCGGATGGATTTGAGTCACTCTAAGGATCTGAAAGAGATTCCAGATCTTTCAAATGCTACTAATCTCGAGGAACTAGATCTCTCTAGCTGCTCAGGTTTGTTAGAGCTCACCGACTCTATTGGAAAAGCCACTAATCTTAAGAGATTGAAACTTGCCTGTTGCTCTCTTTTGAAAAAGCTACCTTCCTCTATCGGAGATGCCACGAATCTCCAAGTGTTGGATCTTTTCCATTGCGAAAGTTTCGAGGAACTCCCCAAATCTATTGGTAAGTTAACTAATCTCAAGGTATTGGAACTCATGCGTTGTTATAAACTGGTGACTCTCCCCAACTCTATCAAGACACCTAAATTGCCGGTCTTGAGCATGAGCGAATGCGAAGATCTACAGGCGTTTCCAACCTACATCAACCTTGAGGATTGTACACAGTTGAAAATGTTTCCAGAAATTTCAACAAACGTTAAAGAACTCGATCTGAGAAATACTGCAATAGAGAACGTGCCATCTTCGATATGCTCTTGGTCTTGTCTTTACAGATTGGATATGTCAGAGTGTAGAAACCTCAAGGAGTTCCCAAATGTTCCTGTCAGCATCGTAGAGTTGGACTTGAGCAAGACAGAGATAGAGGAAGTTCCTTCATGGATTGAGAATCTCTTACTTCTGCGTACTCTAACTATGGTAGGATGCAAGAGGCTTAATATTATATCTCCAAACATTTCTAAGTTGAAGAATCTTGAAGATCTTGAACTGTTTACCGACGGTGTTTCTGGGGATGCTGCATCTTTTTATGCATTCGTTGAGTTCTCTGACCGGCATGATTGGACTTTAGAATCAGACTTTCAAGTTCACTACATTTTACCGATATGTCTACCCAAGATGGCAATATCATTACGCTTCTGGAGTTATGATTTCGAGACTATTCCAGATTGCATTAACTGTCTCCCCGGGCTTAGTGAGCTTGACGTTAGTGGATGCAGAAATCTCGTCTCACTCCCACAGCTTCCGGGTTCCCTTTTATCTCTAGATGCAAATAACTGTGAATCTTTGGAGAGAATAAACGGCTCTTTTCAAAACCCAGAGATTTGTCTAAACTTTGCTAACTGCATCAACCTGAATCAAGAAGCGAGAAAGCTCATCCAGACATCAGCTTGCGAATATGCGATCTTACCTGGTGCAGAAGTTCCTGCACACTTCACTGACCAAGATACTTCAGGCTCCCTAACGATCAACATAACTACTAAGACTCTTCCTTCACGCTTAAGATATAAAGCTTGCATCTTGCTGTCAAAAGGCAATATAAATCTTGAGGATGAGGATGAGGATTCGTTTATGTCTGTGTCTTGTCACGTCACGGGGAAACAGAATATCCTTATTCTCCCTTCACCAGTTCTACGTGGATATACAGATCACTTGTATATATTTGATTATTCTTTCTCTCTACATGAGGATTTCCCTGAAGCCAAAGAAGCCACTTTCAGCGAGCTTATGTTTGACTTCATAGTCCACACTAAATCCTGGAACGTGAAAAGCTGCGGTGTACATCTTTTTGAGAAGAGCAGCTCCATGCCATCCGGCACAATCAATCTGGGGTTTATCCAGGTTTCAAGAATGTCGTTAGATTTGAGCAGTGATAGCAACTAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MQPNRASSSLSSTPTRTWTHHVFLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQALIDVSNIVGEVYRIWSKESDLIDKIAEDVLDELNYTMSRDFDGYVGIGRHMRKMKSLLCLESGDVRMIGIVGPPGIGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPRKDDALQIFCLSAFGQNFPHDDFQYLACEVTQLAGELPLGLKVLGSYLKGMSLEEWKNALPRLKTCLDGDIEKTLRYSYDALSRKDQALFLHIACLFRGYEVGHVKQWLGKSDLDVDHGLDVLRQKSLISIDMGFLNMHSLLQQLGVEIVRNQSSQEPRERQFLVDVNDISDVFTYNTAGTKSILGIRLNVPEIEEKIVIDELVFDGMTNLQFLFVNEGFGDKLSLPRGLNCLPGKLRVLHWNYCPLRLWPSKFSANFLVELVMRGNNFEKLWEKILPLKSLKRMDLSHSKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEVPAHFTDQDTSGSLTINITTKTLPSRLRYKACILLSKGNINLEDEDEDSFMSVSCHVTGKQNILILPSPVLRGYTDHLYIFDYSFSLHEDFPEAKEATFSELMFDFIVHTKSWNVKSCGVHLFEKSSSMPSGTINLGFIQVSRMSLDLSSDSN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
8-159 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

SSLSSTPTRTWTHHVFLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQALIDVSNIVGE

Gene3D: G3DSA:3.40.50.10140
16-149 no description

RTWTHHVFLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQA

ProfileScan: PS50104
IPR000157
18-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WTHHVFLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQALIDVSNI

HMMSmart: SM00255
IPR000157
19-156 Toll
Toll/interleukin-1 receptor homology (TIR) domain

THHVFLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQALIDVSNI

HMMPfam: PF01582
IPR000157
22-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQAL

HMMPanther: PTHR23155:SF300
23-1041 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE

FLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQALIDVSNIVGEVYRIWSKESDLIDKIAEDVLDELNYTMSRDFDGYVGIGRHMRKMKSLLCLESGDVRMIGIVGPPGIGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPRKDDALQIFCLSAFGQNFPHDDFQYLACEVTQLAGELPLGLKVLGSYLKGMSLEEWKNALPRLKTCLDGDIEKTLRYSYDALSRKDQALFLHIACLFRGYEVGHVKQWLGKSDLDVDHGLDVLRQKSLISIDMGFLNMHSLLQQLGVEIVRNQSSQEPRERQFLVDVNDISDVFTYNTAGTKSILGIRLNVPEIEEKIVIDELVFDGMTNLQFLFVNEGFGDKLSLPRGLNCLPGKLRVLHWNYCPLRLWPSKFSANFLVELVMRGNNFEKLWEKILPLKSLKRMDLSHSKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEV

HMMPanther: PTHR23155
23-1041 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSFRGEDVRKGFLSHIQKEFERKGIFPFVDTKMKRGSSIGPVLSDAIIVSKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQALIDVSNIVGEVYRIWSKESDLIDKIAEDVLDELNYTMSRDFDGYVGIGRHMRKMKSLLCLESGDVRMIGIVGPPGIGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPRKDDALQIFCLSAFGQNFPHDDFQYLACEVTQLAGELPLGLKVLGSYLKGMSLEEWKNALPRLKTCLDGDIEKTLRYSYDALSRKDQALFLHIACLFRGYEVGHVKQWLGKSDLDVDHGLDVLRQKSLISIDMGFLNMHSLLQQLGVEIVRNQSSQEPRERQFLVDVNDISDVFTYNTAGTKSILGIRLNVPEIEEKIVIDELVFDGMTNLQFLFVNEGFGDKLSLPRGLNCLPGKLRVLHWNYCPLRLWPSKFSANFLVELVMRGNNFEKLWEKILPLKSLKRMDLSHSKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEV

superfamily: SSF52540
73-456 P-loop containing nucleoside triphosphate hydrolases

SKIAIVLLSKNYASSTWCLNELVNIMKCREEFGQTVMTVFYEVDPSDVRKQTGDFGIAFETTCVGKTEEVKQSWRQALIDVSNIVGEVYRIWSKESDLIDKIAEDVLDELNYTMSRDFDGYVGIGRHMRKMKSLLCLESGDVRMIGIVGPPGIGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPRKDDALQIFCLSAFGQNFPHDDFQYLACEVTQLAGELPLGLKVLGSYLKGMSLEEWKNALPRLKTCLDGDIEKTLRYSYDALSRKDQALFL

Gene3D: G3DSA:3.40.50.300
186-228 no description

MSRDFDGYVGIGRHMRKMKSLLCLESGDVRMIGIVGPPGIGKT

HMMPfam: PF00931
IPR002182
199-469 NB-ARC,NBS
NB-ARC

HMRKMKSLLCLESGDVRMIGIVGPPGIGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPRKDDALQIFCLSAFGQNFPHDDFQYLACEVTQLAGELPLGLKVLGSYLKGMSLEEWKNALPRLKTCLDGDIEKTLRYSYDALSRKDQALFLHIACLFRGYEVGH

HMMSmart: SM00382
IPR003593
213-366 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

DVRMIGIVGPPGIGKTTIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPR

FPrintScan: PR00364
IPR000767
216-231 DISEASERSIST
Disease resistance protein

MIGIVGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
229-374 no description

TIARALRDQISENFQLTAFIDDIRLTYPRRCYGESGLKPPTAFMNDDRRKIVLQTNFLSEILNQKDIVIHNLNAAPNWLKDRKVLVILDDVDHLEQLDAMAKETGWFGYGSRIIITTQDRKLLKAHNIDYIYEVGLPRKDDALQIF

FPrintScan: PR00364
IPR000767
306-320 DISEASERSIST
Disease resistance protein

WLKDRKVLVILDDVD

FPrintScan: PR00364
IPR000767
399-413 DISEASERSIST
Disease resistance protein

AGELPLGLKVLGSYL

Gene3D: G3DSA:3.80.10.10
591-787 no description

LPRGLNCLPGKLRVLHWNYCPLRLWPSKFSANFLVELVMRGNNFEKLWEKILPLKSLKRMDLSHSKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLED

superfamily: SSF52047
601-839 RNI-like,LRR

KLRVLHWNYCPLRLWPSKFSANFLVELVMRGNNFEKLWEKILPLKSLKRMDLSHSKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFP

FPrintScan: PR00364
IPR000767
665-681 DISEASERSIST
Disease resistance protein

SNATNLEELDLSSCSGL

HMMPfam: PF13504
668-681 LRR_7,Leucine rich repeat

TNLEELDLSSCSGL

Seg: seg
694-708 seg

LKRLKLACCSLLKKL

HMMPfam: PF00560
IPR001611
717-739 LRR_1
Leucine-rich repeat

NLQVLDLFHCESFEELPKSIGKL

HMMPfam: PF13504
740-757 LRR_7,Leucine rich repeat

TNLKVLELMRCYKLVTLP

superfamily: SSF52058
782-1018 L domain-like,LRR

YINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINL

Gene3D: G3DSA:3.80.10.10
951-1004 no description

FETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQ

HMMPfam: PF13504
963-979 LRR_7,Leucine rich repeat

GLSELDVSGCRNLVSLP

Seg: seg
975-988 seg

LVSLPQLPGSLLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox