PRGDB00046961 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18413456 (NM_117187)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G11170) mRNA, complete cds.

DNA Sequence

ATGGCATCTTCTTCTTCAAACTCTTGGAGATACGACGTCTTTCCTAGTTTCAGAGGGGAAGATGTCCGTAATAACTTTCTCAGCCACTTGCTCAAAGAATTTGAAAGCAAAGGAATAGTGACATTCAGAGATGACCATATCAAAAGAAGCCACACGATCGGTCATGAGCTTAGAGCAGCCATTAGAGAATCTAAGATCTCAGTAGTCTTGTTCTCAGAGAACTATGCTTCTTCAAGCTGGTGTTTGGACGAGCTGATTGAGATCATGAAGTGTAAGGAAGAACAAGGACTGAAAGTGATGCCGGTTTTCTACAAAGTGGATCCATCTGATATAAGAAAACAGACCGGAAAGTTTGGAATGAGTTTCTTGGAAACTTGTTGTGGTAAGACGGAGGAGCGACAACATAACTGGAGGCGGGCGTTGACTGATGCTGCCAATATTCTTGGAGATCATCCTCAAAATTGGGACAATGAAGCATATAAGATCACAACAATTTCCAAGGATGTATTAGAAAAATTAAATGCAACGCCATCAAGAGATTTCAATGACTTGGTTGGAATGGAAGCTCACATTGCAAAGATGGAATCATTGTTATGCCTTGAGTCTCAAGGAGTGAGGATAGTAGGGATATGGGGTCCTGCAGGCGTTGGTAAGACTACCATAGCTAGAGCTTTATATAACCAATATCATGAAAACTTCAATCTTTCTATATTTATGGAGAATGTTAGAGAAAGTTATGGTGAAGCAGGCCTCGATGACTATGGTTTGAAGCTGCATTTACAACAAAGATTTTTATCCAAACTTCTTGATCAAAAGGATTTGAGAGTACGTCATTTAGGCGCAATAGAAGAAAGGCTAAAGAGCCAAAAAGTTCTAATTATTCTTGATGATGTGGACAATATTGAGCAACTCAAAGCCTTGGCAAAGGAAAATCAATGGTTTGGTAACAAGAGCAGAATTGTCGTGACAACCCAAAACAAACAACTTTTGGTTTCTCATGATATCAACCATATGTACCAGGTGGCTTATCCTTCAAAACAAGAAGCTCTTACTATATTTTGCCAGCATGCTTTTAAGCAAAGTTCCCCATCAGATGATTTAAAGCACCTTGCAATTGAATTTACAACTCTTGCTGGTCATCTTCCGCTGGCTCTACGGGTTCTTGGTTCGTTTATGCGTGGAAAGGGTAAGGAAGAGTGGGAATTTTCCCTGCCTACGCTAAAAAGTCGACTTGATGGAGAGGTAGAGAAAGTATTAAAAGTCGGGTATGATGGCTTGCATGACCATGAAAAAGATTTATTTCTTCATATTGCATGTATTTTTAGCGGTCAACACGAAAACTATTTGAAACAGATGATCATAGCTAACAATGACACATATGTTAGTTTCGGACTTCAAGTCCTGGCTGATAAATCTCTCATACAAAAATTTGAGAATGGTAGAATCGAGATGCACTCCTTACTACGACAATTAGGCAAAGAAGTTGTTCGAAAGCAATCTATTTACGAGCCAGGAAAACGTCAATTCTTGATGAATGCTAAGGAAACGTGTGGCGTCCTTTCAAACAATACTGGTACGGGAACTGTATTAGGTATATCGTTAGATATGTGTGAGATCAAAGAGGAGTTATATATAAGTGAGAAAACTTTTGAAGAGATGCGGAACCTCGTATATCTAAAATTCTATATGAGTAGTCCTATAGATGATAAAATGAAAGTCAAGTTGCAGTTACCAGAAGAAGGGCTAAGCTATCTACCGCAATTGAGGTTATTACACTGGGATGCATATCCTCTTGAGTTTTTCCCTTCTAGCTTTCGACCCGAATGTCTTGTCGAACTCAACATGTCTCATAGCAAGCTTAAGAAGCTATGGAGTGGAGTTCAGCCGCTTAGAAATCTCAGGACAATGAATCTAAATAGCTCTCGGAATCTGGAAATCCTTCCAAATCTTATGGAAGCAACAAAGCTTAACAGATTGGATTTGGGTTGGTGTGAGTCTTTGGTGGAGCTTCCTTCATCTATAAAGAACCTTCAGCATCTGATTTTGTTAGAGATGTCTTGTTGCAAAAAATTAGAGATCATCCCAACTAACATCAACTTACCATCTCTAGAGGTCCTCCACTTTAGGTATTGCACACGATTGCAAACCTTTCCAGAGATTTCAACCAATATTCGTCTTCTCAATTTAATAGGCACTGCGATCACTGAGGTGCCTCCATCAGTAAAATATTGGAGTAAAATTGATGAAATTTGTATGGAGAGGGCTAAGGTCAAGAGATTGGTTCATGTTCCTTATGTTTTAGAAAAGCTATGTTTGAGGGAAAATAAAGAATTGGAGACTATTCCGCGATACCTCAAATATCTCCCTCGGCTGCAGATGATTGACATCTCCTATTGCATCAATATTATATCGCTACCGAAGCTTCCAGGCTCAGTATCCGCCTTAACAGCTGTAAACTGCGAGTCACTTCAAATACTACATGGCCACTTTCGAAACAAAAGTATCCACCTGAATTTCATTAACTGTTTAAAGCTAGGTCAGAGAGCCCAAGAAAAGATCCACCGGTCAGTTTACATCCACCAGTCCTCATACATAGCTGATGTCTTACCTGGTGAACATGTACCTGCGTACTTCAGCTACCGAAGTACCGGAAGTTCCATAATGATCCATTCAAATAAGGTTGATCTTTCAAAGTTTAACAGGTTTAAGGTATGCCTTGTGCTTGGAGCGGGAAAACGTTTCGAAGGTTGTGACATAAAATTTTACAAACAATTTTTCTGTAAACCGAGAGAGTATTACGTGCCAAAGCATTTGGATTCACCACTACTTAAAAGTGATCATCTTTGCATGTGCGAGTTTGAATTAATGCCACCACATCCTCCAACGGAATGGGAGCTTCTCCACCCAAACGAATTCCTGGAGGTTTCCTTTGAGAGTCGCGGCGGCCTTTATAAGTGCGAAGTAAAAGAATGCGGTTTACAGTTCCTGGAGCCTCATGAGACATCTGAGTTTCGGTATCTGTCACCTCATCTGTACTTGGGTGGTAGTTGGATTGGAAATAGTAGTAGTAGTATTGAAGAAATTATCCATGTAGACCAAGAGGAAAGCAGTAGTGATAGTGAAGAAATTATCTATGCGGACCAAGAGGAAAGCAGTAGTGGTATTGAGGAAATTATCCATGCAGAAAGAGAAGGAACCAACAGGAGGAAATCTGTTATGAGATGGATTAAGGTTGGAGCAAGAAAAATGGGTCTTAGTTTGGAGTGTCTAAAGCCCTGGACAAGATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSNSWRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHGHFRNKSIHLNFINCLKLGQRAQEKIHRSVYIHQSSYIADVLPGEHVPAYFSYRSTGSSIMIHSNKVDLSKFNRFKVCLVLGAGKRFEGCDIKFYKQFFCKPREYYVPKHLDSPLLKSDHLCMCEFELMPPHPPTEWELLHPNEFLEVSFESRGGLYKCEVKECGLQFLEPHETSEFRYLSPHLYLGGSWIGNSSSSIEEIIHVDQEESSSDSEEIIYADQEESSSGIEEIIHAEREGTNRRKSVMRWIKVGARKMGLSLECLKPWTR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSNSWRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILG

Gene3D: G3DSA:3.40.50.10140
7-141 G3DSA:3.40.50.10140

NSWRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRAL

ProfileScan: PS50104
IPR000157
9-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANI

HMMSmart: SM00255
IPR000157
10-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANI

HMMPfam: PF01582
IPR000157
13-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALT

HMMPanther: PTHR11017
33-1070 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHGHFRNKSIHLNFINCLKLGQRAQEKIHRSVYIHQSSYIADVLPGEHVPAYFSYRSTGSSIMIHSNKVDLSKFNRFKVCLVLGAGKRFEGCDIKFYKQFFCKPREYYVPKHLDSPLLKSDHLCMCEFELMPPHPPTEWELLHPNEFLEVSFESRGGLYKCEVKECGLQFLEPHETSEFRYLSPHLYLGGSWIGNSSSSIEEIIHVDQEESSSDSEEIIYADQEESSSGIEEIIHAEREGTNRRK

HMMPanther: PTHR11017:SF20
33-1070 PTHR11017:SF20,SUBFAMILY NOT NAMED

EFESKGIVTFRDDHIKRSHTIGHELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHGHFRNKSIHLNFINCLKLGQRAQEKIHRSVYIHQSSYIADVLPGEHVPAYFSYRSTGSSIMIHSNKVDLSKFNRFKVCLVLGAGKRFEGCDIKFYKQFFCKPREYYVPKHLDSPLLKSDHLCMCEFELMPPHPPTEWELLHPNEFLEVSFESRGGLYKCEVKECGLQFLEPHETSEFRYLSPHLYLGGSWIGNSSSSIEEIIHVDQEESSSDSEEIIYADQEESSSGIEEIIHAEREGTNRRK

superfamily: SSF52540
64-435 SSF52540

SKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQTGKFGMSFLETCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLEKLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFL

Gene3D: G3DSA:3.40.50.300
176-333 G3DSA:3.40.50.300

TPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSH

HMMPfam: PF00931
IPR002182
188-452 NB-ARC,NBS
NB-ARC

EAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQM

HMMSmart: SM00382
IPR003593
204-388 AAA,NBS
AAA+ ATPase domain

GVRIVGIWGPAGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAIEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVL

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

IVGIWGPAGVGKTTIA

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RLKSQKVLIILDDVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

AGHLPLALRVLGSFM

superfamily: SSF46785
413-521 SSF46785

GEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLS

Gene3D: G3DSA:3.80.10.10
546-826 G3DSA:3.80.10.10

SEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQIL

superfamily: SSF52058
561-828 SSF52058,LRR

FYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVSALTAVNCESLQILHG

HMMPfam: PF07725
IPR011713
609-628 LRR_3
Leucine-rich repeat 3

CLVELNMSHSKLKKLWSGVQ

FPrintScan: PR00364
IPR000767
628-644 DISEASERSIST
Disease resistance protein

QPLRNLRTMNLNSSRNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox