PRGDB00046962 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42562081 (NM_101457)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G15890) mRNA, complete cds.

DNA Sequence

ATGGGAAACTGTGTAGCACTAGAAATATCTTGTGATCAAACGTTGAATCATGCTTGTGGCTGCTTATTTGGTGATCGGAATTACATTCTCAAGATGGAGGCTAATCTCGAGGCTCTGCAGAATACTATGCAAGAGCTCGAGGAGAGAAGAGATGATCTGTTAAGAAGAGTTGTCATAGAAGAAGACAAAGGTTTGCAACGGCTTGCTCAAGTTCAAGGTTGGCTTTCAAGGGTTAAAGATGTTTGTTCTCAAGTCAATGATCTGCTGAAAGCTAAATCAATTCAAACTGAAAGGTTATGTCTCTGTGGATATTGTTCTAAGAATTTCATATCTGGCCGCAATTACGGAATAAATGTACTGAAAAAGTTGAAACACGTGGAAGGACTTCTAGCTAAAGGAGTTTTTGAAGTGGTGGCAGAGAAAATTCCTGCGCCTAAGGTGGAGAAGAAGCATATCCAAACCACAGTTGGGTTGGATGCAATGGTCGGAAGGGCATGGAACAGCCTCATGAAAGATGAACGAAGAACTTTGGGTCTTTATGGTATGGGGGGAGTAGGTAAAACCACGCTCTTAGCTTCTATTAACAACAAATTCCTTGAAGGGATGAATGGATTTGATCTTGTTATATGGGTTGTGGTTTCTAAAGATTTGCAAAATGAAGGCATTCAAGAACAGATTTTAGGAAGACTAGGTCTTCACAGGGGATGGAAACAAGTTACAGAAAAGGAGAAAGCCTCTTACATATGCAACATCCTCAACGTAAAGAAATTTGTGCTGTTATTGGATGATCTATGGAGCGAAGTAGATTTAGAAAAGATTGGAGTTCCACCTCTAACGCGAGAAAATGGATCCAAAATAGTTTTCACCACTCGTTCTAAAGATGTTTGCAGAGATATGGAAGTTGATGGTGAGATGAAAGTTGATTGTTTGCCACCGGATGAAGCCTGGGAACTGTTCCAAAAGAAAGTTGGACCAATCCCATTACAGAGCCATGAGGATATTCCCACACTTGCAAGAAAAGTAGCAGAAAAATGTTGTGGCTTGCCACTTGCACTCAGTGTCATTGGCAAAGCTATGGCATCTAGAGAGACTGTTCAGGAATGGCAGCATGTGATTCATGTTCTGAACTCGTCTAGCCACGAGTTCCCAAGTATGGAAGAAAAAATTCTTCCTGTTTTGAAGTTCAGTTATGATGATTTAAAAGATGAAAAAGTCAAATTGTGCTTCCTTTATTGTTCCCTGTTTCCGGAAGATTATGAAGTAAGAAAGGAAGAGTTGATAGAATATTGGATGTGTGAAGGATTTATAGATGGGAATGAAGATGAAGATGGAGCTAACAACAAAGGTCATGACATAATTGGCTCGTTAGTTCGTGCACATCTATTGATGGATGGTGAACTAACAACAAAAGTGAAAATGCATGATGTCATACGCGAGATGGCTCTTTGGATAGCGTCGAACTTTGGAAAACAGAAAGAAACACTTTGTGTGAAACCCGGTGTGCAGTTATGCCATATACCAAAGGACATCAATTGGGAAAGTTTGAGAAGGATGTCTTTGATGTGCAATCAGATTGCAAATATATCTTCTAGTTCCAACTCTCCCAACCTCTCAACTCTATTACTCCAGAATAACAAGTTGGTGCATATATCATGTGACTTTTTTAGGTTTATGCCAGCACTCGTGGTCTTGGATCTTTCGAGGAACTCGAGTCTCTCTAGCTTGCCGGAAGCAATTTCTAAGTTAGGTTCCTTGCAATATATCAACTTATCAACAACAGGGATAAAATGGTTGCCAGTTAGTTTTAAGGAGTTGAAGAAATTAATCCATTTGAATCTGGAGTTTACTGATGAACTTGAAAGTATTGTTGGGATAGCTACAAGCCTACCAAACCTGCAAGTGTTGAAATTGTTTTCTTCTCGTGTTTGTATTGATGGCAGTTTAATGGAAGAGTTACTACTCTTGGAGCACTTGAAGGTTTTAACAGCAACTATAAAGGACGCCTTGATTTTGGAAAGTATACAAGGAGTGGACCGATTGGTGAGTAGTATTCAAGCTTTATGTCTCAGAAATATGTCAGCACCGGTTATAATATTGAACACGGTAGCTCTGGGTGGTCTTCAACACCTTGAAATCGTGGGCTCCAAAATCTCAGAGATAAAGATAGATTGGGAAAGAAAAGGAAGAGGGGAGCTTAAATGTACAAGTTCTCCTGGCTTTAAGCACCTCTCTGTTGTTGAAATATTCAATTTGGAAGGTCCAAGGGATTTAACATGGCTGTTGTTTGCTCAAAACCTCAGGCGTCTATCTGTGACGCTGTCATTAACCATAGAAGAGATAATAAACAAGGAGAAAGGAATGAGTATTACCAATGTGCATCCAAATATCGTTGTTCCGTTTGGGAAGCTGGAATTCCTTGAAGTAAGGGGTTTGGATGAGTTAAAGAGAATCTGCTGGAATCCCCCGGCTCTTCCAAACCTGAGACAATTTGATGTACGAAGCTGCCTTAAGCTACCGGAAGCTGCCACTGAGTTTCCGCGACATGCCAATGAATAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MGNCVALEISCDQTLNHACGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRVKDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRNYGINVLKKLKHVEGLLAKGVFEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFIDGNEDEDGANNKGHDIIGSLVRAHLLMDGELTTKVKMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSCLKLPEAATEFPRHANE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF113
1-838 PTHR23155:SF113,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

MGNCVALEISCDQTLNHACGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRVKDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRNYGINVLKKLKHVEGLLAKGVFEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFIDGNEDEDGANNKGHDIIGSLVRAHLLMDGELTTKVKMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSCLKL

HMMPanther: PTHR23155
1-838 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGNCVALEISCDQTLNHACGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRVKDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRNYGINVLKKLKHVEGLLAKGVFEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFIDGNEDEDGANNKGHDIIGSLVRAHLLMDGELTTKVKMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSCLKL

Gene3D: G3DSA:3.80.10.10
77-100 G3DSA:3.80.10.10

RVKDVCSQVNDLLKAKSIQTERLC

superfamily: SSF52540
135-371 SSF52540

FEVVAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHV

HMMPfam: PF00931
IPR002182
159-437 NB-ARC,NBS
NB-ARC

DAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVCRDMEVDGEMKVDCLPPDEAWELFQKKVGPIPLQSHEDIPTLARKVAEKCCGLPLALSVIGKAMASRETVQEWQHVIHVLNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFLYCSLFPEDYEVRKEELIEYWMCEGFID

Gene3D: G3DSA:3.40.50.300
166-296 G3DSA:3.40.50.300

WNSLMKDERRTLGLYGMGGVGKTTLLASINNKFLEGMNGFDLVIWVVVSKDLQNEGIQEQILGRLGLHRGWKQVTEKEKASYICNILNVKKFVLLLDDLWSEVDLEKIGVPPLTRENGSKIVFTTRSKDVC

FPrintScan: PR00364
IPR000767
176-191 DISEASERSIST
Disease resistance protein

TLGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

ILNVKKFVLLLDDLW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CCGLPLALSVIGKAM

superfamily: SSF52058
472-835 SSF52058,LRR

KMHDVIREMALWIASNFGKQKETLCVKPGVQLCHIPKDINWESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKDALILESIQGVDRLVSSIQALCLRNMSAPVIILNTVALGGLQHLEIVGSKISEIKIDWERKGRGELKCTSSPGFKHLSVVEIFNLEGPRDLTWLLFAQNLRRLSVTLSLTIEEIINKEKGMSITNVHPNIVVPFGKLEFLEVRGLDELKRICWNPPALPNLRQFDVRSC

Gene3D: G3DSA:3.80.10.10
513-667 G3DSA:3.80.10.10

ESLRRMSLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTTGIKWLPVSFKELKKLIHLNLEFTDELESIVGIATSLPNLQVLKLFSSRVCIDGSLMEELLLLEHLKVLTATIKD

HMMPfam: PF13855
535-593 LRR_8,Leucine rich repeat

PNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRNSSLSSLPEAISKLGSLQYINLSTT

FPrintScan: PR00364
IPR000767
556-572 DISEASERSIST
Disease resistance protein

RFMPALVVLDLSRNSSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox