PRGDB00046964 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18406284 (NM_104620)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G58400) mRNA, complete cds.

DNA Sequence

ATGGTCGAGGCAATTGTTTCATTTGGAGTAGAAAAGCTTTGGGACCGACTGACCCAAGAATACGAGCAATTTCAAGGAGTTGAAGATCGAATAGCTGAACTAAAAAGTAATCTAAACTTGTTAAAGTCCTTTTTGAAAGATGCAGAAGCCAAGAAAAATACAAGTCAGATGGTGCGACATTGTGTTGAAGAGATTAAAGAAATTGTTTATGATACGGAGAATATGATCGAAACGTTTATTCTCAAAGAAGCAGCCCGAAAAAGAAGTGGCATCATCAGGCGTATCACAAAACTAACTTGCATTAAAGTGCATCGTTGGGAATTTGCGTCCGATATTGGAGGCATAAGTAAGAGGATCTCTAAGGTGATTCAAGACATGCATAGTTTTGGAGTACAACAGATGATTTCCGATGGTAGTCAGTCTTCACATCTACTACAAGAAAGAGAAAGGGAGATGCGACAAACGTTTTCTAGGGGTTACGAAAGCGACTTTGTGGGGTTGGAGGTAAATGTTAAGAAACTGGTTGGATATTTGGTGGAGGAAGATGACATTCAAATTGTTTCGGTAACCGGGATGGGAGGTCTTGGTAAAACCACCCTTGCAAGACAAGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATAGACTCGCATGGGTGTGTGTCTCACAAGAGTTTACTCGGAAAAATGTATGGCAAATGATCTTGCAGAATCTAACCTCTAGAGAAACGAAAGATGAAATCTTGCAAATGGAAGAAGCTGAACTCCATGATGAACTCTTTCAGCTATTGGAGACATCTAAATCATTAATTGTTTTTGATGACATATGGAAAGAAGAAGACTGGGGCCTAATCAATCCAATATTTCCACCAAAAAAAGAGACTATCGCAATGCATGGAAATAGAAGATATGTCAACTTTAAACCAGAATGCCTAACTATTCTAGAGAGTTGGATACTTTTCCAAAGAATTGCAATGCCAAGGGTAGATGAATCAGAATTCAAGGTTGATAAGGAAATGGAAATGATGGGTAAGCAAATGATTAAATATTGTGGAGGACTACCATTGGCCGTCAAAGTGTTGGGAGGGTTGTTAGCTGCAAAATACACTTTTCATGATTGGAAACGATTATCTGAGAATATTGGATGTCATATCGTGGGAAGAACCGATTTCAGTGACGGTAACAACAGTTCAGTTTACCATGTATTGTCTCTGAGCTTTGAAGAGTTGCCTAGTTATTTGAAGCATTGCTTCCTCTACTTGGCCCATTTTCCAGAAGATCATAACATAAAGGTAGAAAAATTGTCTTATTGTTGGGCTGCTGAAGGAATATTAGAACCTCGACATTACCATGGACAGACTATTCGAGATGTTGGAGAAAGCTACATAGAGGAGTTAGTGAGGAGAAATATGGTTATTGCCGAAAGAGATGTTACGACTTTGAGATTTGAAGCTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTAAAAGCCAAAGAAGAGAACTTCGTTCAAATCGCAAGTATCCTCCCTCCAACCGCAAACTCGCAATATCCTGGTACATCTCGCAGATTTGTCTCACAAAATCCTACTACATTACATGTTAGTAGAGATATAAATAATCCAAAACTTCAATCTCTCCTTATTGTATGGGAGAACAGAAGAAAGAGTTGGAAGCTATTAGGTTCAAGCTTTATAAGGTTAGAACTACTGAGGGTATTAGATCTCTATAAAGCCAAGTTTGAAGGGAGAAATTTACCTTCTGGCATTGGAAAGCTCATCCACTTGAGATACTTGAACTTAGATTTGGCTCGTGTATCTCGTCTACCTTCTTCTCTAGGAAACCTAAGGTTGCTGATCTATCTAGACATAAATGTATGCACGAAATCTCTATTCGTGCCCAATTGCTTGATGGGGATGCATGAATTAAGATACCTTAGACTACCATTTAATACGTCGAAGGAGATAAAGTTGGGACTGTGTAATCTCGTAAACTTGGAGACCTTAGAGAATTTCTCAACAGAGAATAGCAGCTTAGAGGATCTTCGTGGTATGGTAAGTTTGAGGACTCTCACCATTGGTTTATTTAAGCACATTAGTAAAGAGACTCTGTTTGCATCAATACTTGGGATGAGGCACCTGGAAAATCTTAGCATAAGGACACCAGACGGGTCTTCAAAGTTTAAAAGGATAATGGAAGATGGAATCGTATTGGATGCCATTCATCTAAAACAATTGAATTTGAGGTTATATATGCCAAAGTTACCTGATGAACAACACTTCCCTTCTCACCTTACAAGCATATCTCTAGATGGTTGTTGTTTGGTGGAGGATCCGTTACCGATTCTAGAGAAATTACTTGAGTTGAAAGAGGTTCGTTTAGACTTTCGAGCTTTCTGTGGGAAGAGAATGGTTAGCTCGGACGGTGGGTTTCCTCAATTGCACAGGCTATATATATGGGGATTAGCTGAGTGGGAAGAGTGGATAGTAGAAGAAGGCTCCATGCCACGTCTTCATACTCTGACTATATGGAATTGTCAAAAATTAAAGCAGCTTCCTGATGGTTTGCGATTCATCTATTCTATAAAAGATTTGGATATGGACAAGAAATGGAAGGAAATATTGTCAGAAGGAGGAGAAGAATATTACAAAGTCCAACACATTCCTTCTGTTAAATTCGAAAAGGACTACAAATAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MVEAIVSFGVEKLWDRLTQEYEQFQGVEDRIAELKSNLNLLKSFLKDAEAKKNTSQMVRHCVEEIKEIVYDTENMIETFILKEAARKRSGIIRRITKLTCIKVHRWEFASDIGGISKRISKVIQDMHSFGVQQMISDGSQSSHLLQEREREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRHYHGQTIRDVGESYIEELVRRNMVIAERDVTTLRFEACHLHDMMREVCLLKAKEENFVQIASILPPTANSQYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDKKWKEILSEGGEEYYKVQHIPSVKFEKDYK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-895 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VEAIVSFGVEKLWDRLTQEYEQFQGVEDRIAELKSNLNLLKSFLKDAEAKKNTSQMVRHCVEEIKEIVYDTENMIETFILKEAARKRSGIIRRITKLTCIKVHRWEFASDIGGISKRISKVIQDMHSFGVQQMISDGSQSSHLLQEREREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRHYHGQTIRDVGESYIEELVRRNMVIAERDVTTLRFEACHLHDMMREVCLLKAKEENFVQIASILPPTANSQYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDKKWKEILSEGGEEYYKVQHIPSVKF

HMMPanther: PTHR23155:SF233
2-895 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VEAIVSFGVEKLWDRLTQEYEQFQGVEDRIAELKSNLNLLKSFLKDAEAKKNTSQMVRHCVEEIKEIVYDTENMIETFILKEAARKRSGIIRRITKLTCIKVHRWEFASDIGGISKRISKVIQDMHSFGVQQMISDGSQSSHLLQEREREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRHYHGQTIRDVGESYIEELVRRNMVIAERDVTTLRFEACHLHDMMREVCLLKAKEENFVQIASILPPTANSQYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDKKWKEILSEGGEEYYKVQHIPSVKF

Coil: coil
17-52 coiled-coil

LTQEYEQFQGVEDRIAELKSNLNLLKSFLKDAEAKK

Seg: seg
34-46 seg

LKSNLNLLKSFLK

superfamily: SSF52540
148-389 P-loop containing nucleoside triphosphate hydrolases

REREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRT

HMMPfam: PF00931
IPR002182
169-449 NB-ARC,NBS
NB-ARC

VNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRH

Gene3D: G3DSA:3.40.50.300
176-278 no description

GYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWK

FPrintScan: PR00364
IPR000767
186-201 DISEASERSIST
Disease resistance protein

IVSVTGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

LLETSKSLIVFDDIW

FPrintScan: PR00364
IPR000767
351-365 DISEASERSIST
Disease resistance protein

CGGLPLAVKVLGGLL

Seg: seg
352-368 seg

GGLPLAVKVLGGLLAAK

superfamily: SSF52058
519-871 L domain-like,LRR

QYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDK

Gene3D: G3DSA:3.80.10.10
744-870 no description

HLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMD

Seg: seg
785-793 seg

LEKLLELKE

FPrintScan: PR00364
IPR000767
835-851 DISEASERSIST
Disease resistance protein

GSMPRLHTLTIWNCQKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox