PRGDB00046970 (disease resistance protein (CC-NBS-LRR class), putative / PRM1 homolog, putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative / PRM1 homolog, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186491814 (NM_001124043)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative / PRM1 homolog, putative (AT1G58807) mRNA, complete cds.

DNA Sequence

ATGGCTGGGGAACTTATTTCGTTTGGTATACAAAACCTGTGGAACCTACTGAGTCAAGAATGCGAGCTATTTCAGGGAGTCGAAGATCAAGTAACTGAACTAAAAAGGGATCTAAACATGTTAAGCTCTTTTCTGAAAGATGCAAATGCAAAGAAACATACAAGTGCGGTGGTGAAAAACTGTGTTGAAGAGATCAAGGAAATTATCTATGATGGAGAGGATACAATCGAAACATTTGTTCTTGAGCAAAACCTGGGAAAAACAAGTGGTATCAAGAAGAGTATCAGAAGACTTGCTTGCATTATTCCAGATCGGAGGAGATATGCATTAGGTATCGGAGGCTTAAGTAATAGGATCTCCAAGGTGATCCGAGATATGCAGAGTTTTGGAGTGCAACAAGCTATCGTTGATGGTGGGTATAAGCAACCTCAAGGTGATAAACAAAGGGAGATGCGACAAAAATTTTCTAAGGACGACGACAGCGATTTTGTGGGGTTGGAGGCAAATGTTAAGAAATTGGTTGGATATTTGGTGGACGAAGCAAACGTTCAAGTGGTTTCCATAACCGGTATGGGTGGTCTAGGTAAAACCACACTTGCTAAACAGGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATGGGCTCTCATGGGTGTGTGTTTCACAAGATTTTACCCGAATGAATGTATGGCAAAAGATCTTGAGGGACCTCAAACCCAAAGAGGAAGAAAAGAAAATCATGGAGATGACACAAGATACACTCCAAGGTGAACTAATTCGATTGTTGGAAACGTCTAAGTCATTAATTGTCCTCGATGACATATGGGAAAAAGAAGATTGGGAACTAATCAAGCCAATATTTCCACCGACCAAAGGTTGGAAAGTGTTGCTTACTTCTCGAAATGAGAGTGTCGCCATGCGTAGAAATACATCATATATCAACTTTAAACCAGAATGCCTAACCACTGAAGACAGTTGGACACTTTTTCAGAGGATAGCACTTCCTATGAAAGATGCAGCTGAATTTAAGATTGATGAGGAAAAGGAAGAGTTGGGTAAGCTAATGATCAAACACTGTGGAGGGTTACCATTGGCCATCAGAGTGTTAGGAGGTATGTTAGCTGAAAAATACACATCGCATGATTGGAGAAGATTATCTGAGAATATTGGATCTCATCTCGTGGGAGGAAGAACTAACTTTAATGACGACAACAACAATACATGTAACAATGTATTGTCTCTAAGCTTTGAAGAATTGCCAAGTTATTTGAAGCATTGTTTCCTCTACTTGGCCCATTTTCCAGAAGATTATGAGATAAAGGTAGAGAACTTGTCATATTACTGGGCTGCAGAAGGAATATTCCAACCTAGGCATTACGATGGAGAGACCATTCGAGATGTTGGAGATGTCTACATAGAGGAGCTGGTGAGGAGGAATATGGTCATTTCCGAAAGAGATGTAAAGACTTCGAGATTTGAAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTAAAAGCTAAAGAAGAAAACTTCCTACAAATTACCAGTAGCCGCCCTTCAACTGCAAACTTGCAGTCTACTGTCACATCTCGCAGGTTTGTCTACCAATATCCTACTACTTTACATGTTGAGAAAGATATAAACAATCCAAAACTTCGAGCTCTCGTGGTTGTTACCTTGGGAAGTTGGAACCTGGCAGGTTCAAGCTTTACAAGGTTAGAACTTCTGAGGGTGTTAGATCTTATTGAAGTGAAGATTAAAGGAGGGAAGTTAGCTTCTTGCATTGGAAAGCTCATCCACTTAAGATACTTGAGCTTAGAGTATGCAGAGGTAACTCATATACCTTACTCACTAGGAAATCTGAAGTTGTTGATCTATCTGAATTTAGCTTCATTCGGAAGATCTACATTTGTGCCCAATGTCTTGATGGGGATGCAAGAACTGAGATACCTTGCGTTACCATCTGATATGGGGAGGAAGACAAAACTAGAATTGAGTAATCTAGTAAAATTGGAGACTTTAGAGAATTTCTCAACAGAGAATAGCAGCTTGGAGGATCTTTGTGGTATGGTCAGGCTGAGCACGCTCAACATCAAATTAATTGAGGAGACGAGTCTAGAAACTCTAGCTGCATCTATAGGTGGATTGAAATACCTGGAAAAACTTGAAATATATGATCACGGTTCTGAGATGAGGACGAAGGAAGCGGGAATCGTATTTGATTTCGTTCATCTCAAAAGGCTATGGTTGAAACTGTATATGCCTAGGCTTTCTACAGAACAACACTTCCCTTCTCACCTTACAACCTTATATCTAGAAAGTTGTCGGTTGGAAGAGGATCCCATGCCGATTCTAGAGAAGTTGCTACAGTTGAAAGAGCTTGAATTAGGGTTTGAATCTTTCAGTGGAAAGAAAATGGTTTGCTCGAGCGGTGGGTTTCCTCAATTGCAAAGGCTTTCATTACTGAAACTAGAGGAATGGGAAGATTGGAAAGTAGAAGAAAGCTCCATGCCACTTCTTCGTACTCTCGATATTCAGATCCATTGCCGACTCTAG


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative / PRM1 homolog, putative disease resistance protein (CC-NBS-LRR class), putative / PRM1 homolog, putative [Arabidopsis thaliana].

MAGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNMLSSFLKDANAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRHYDGETIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLASFGRSTFVPNVLMGMQELRYLALPSDMGRKTKLELSNLVKLETLENFSTENSSLEDLCGMVRLSTLNIKLIEETSLETLAASIGGLKYLEKLEIYDHGSEMRTKEAGIVFDFVHLKRLWLKLYMPRLSTEQHFPSHLTTLYLESCRLEEDPMPILEKLLQLKELELGFESFSGKKMVCSSGGFPQLQRLSLLKLEEWEDWKVEESSMPLLRTLDIQIHCRL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-855 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNMLSSFLKDANAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRHYDGETIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLASFGRSTFVPNVLMGMQELRYLALPSDMGRKTKLELSNLVKLETLENFSTENSSLEDLCGMVRLSTLNIKLIEETSLETLAASIGGLKYLEKLEIYDHGSEMRTKEAGIVFDFVHLKRLWLKLYMPRLSTEQHFPSHLTTLYLESCRLEEDPMPILEKLLQLKELELGFESFSGKKMVCSSGGFPQLQRLSLLKLEEWEDWKVEESSMPLLRTLDIQIHCRL

HMMPanther: PTHR23155:SF241
2-855 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE / PRM1 HOMOLOG, PUTATIV,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AGELISFGIQNLWNLLSQECELFQGVEDQVTELKRDLNMLSSFLKDANAKKHTSAVVKNCVEEIKEIIYDGEDTIETFVLEQNLGKTSGIKKSIRRLACIIPDRRRYALGIGGLSNRISKVIRDMQSFGVQQAIVDGGYKQPQGDKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRHYDGETIRDVGDVYIEELVRRNMVISERDVKTSRFETCHLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLASFGRSTFVPNVLMGMQELRYLALPSDMGRKTKLELSNLVKLETLENFSTENSSLEDLCGMVRLSTLNIKLIEETSLETLAASIGGLKYLEKLEIYDHGSEMRTKEAGIVFDFVHLKRLWLKLYMPRLSTEQHFPSHLTTLYLESCRLEEDPMPILEKLLQLKELELGFESFSGKKMVCSSGGFPQLQRLSLLKLEEWEDWKVEESSMPLLRTLDIQIHCRL

superfamily: SSF52540
146-396 P-loop containing nucleoside triphosphate hydrolases

DKQREMRQKFSKDDDSDFVGLEANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVG

HMMPfam: PF00931
IPR002182
167-459 NB-ARC,NBS
NB-ARC

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNESVAMRRNTSYINFKPECLTTEDSWTLFQRIALPMKDAAEFKIDEEKEELGKLMIKHCGGLPLAIRVLGGMLAEKYTSHDWRRLSENIGSHLVGGRTNFNDDNNNTCNNVLSLSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGIFQPRH

Gene3D: G3DSA:3.40.50.300
167-303 no description

EANVKKLVGYLVDEANVQVVSITGMGGLGKTTLAKQVFNHEDVKHQFDGLSWVCVSQDFTRMNVWQKILRDLKPKEEEKKIMEMTQDTLQGELIRLLETSKSLIVLDDIWEKEDWELIKPIFPPTKGWKVLLTSRNE

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

Seg: seg
239-250 seg

KPKEEEKKIMEM

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLETSKSLIVLDDIW

Coil: coil
338-359 coiled-coil

KDAAEFKIDEEKEELGKLMIKH

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAIRVLGGML

Seg: seg
399-411 seg

TNFNDDNNNTCNN

superfamily: SSF52058
497-851 L domain-like,LRR

HLHDMMREVCLLKAKEENFLQITSSRPSTANLQSTVTSRRFVYQYPTTLHVEKDINNPKLRALVVVTLGSWNLAGSSFTRLELLRVLDLIEVKIKGGKLASCIGKLIHLRYLSLEYAEVTHIPYSLGNLKLLIYLNLASFGRSTFVPNVLMGMQELRYLALPSDMGRKTKLELSNLVKLETLENFSTENSSLEDLCGMVRLSTLNIKLIEETSLETLAASIGGLKYLEKLEIYDHGSEMRTKEAGIVFDFVHLKRLWLKLYMPRLSTEQHFPSHLTTLYLESCRLEEDPMPILEKLLQLKELELGFESFSGKKMVCSSGGFPQLQRLSLLKLEEWEDWKVEESSMPLLRTLDIQI

FPrintScan: PR00364
IPR000767
575-591 DISEASERSIST
Disease resistance protein

TRLELLRVLDLIEVKIK

Seg: seg
622-633 seg

LGNLKLLIYLNL

Gene3D: G3DSA:3.80.10.10
773-849 no description

TLYLESCRLEEDPMPILEKLLQLKELELGFESFSGKKMVCSSGGFPQLQRLSLLKLEEWEDWKVEESSMPLLRTLDI

Seg: seg
789-800 seg

LEKLLQLKELEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox