PRGDB00046971 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 79587722 (NM_179069)
Gene Class TN
Domain Type NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT4G16990) mRNA, complete cds.

DNA Sequence

ATGCTTGAAAATATCGCCAAGGATGTTTCAAACAAACTCTTCCCCCCATCAAATAATTTCAGTGACTTCGTCGGGATTGAAGCTCATATAGAGGCATTGATATCAATGTTGCGCTTCGACTCCAAGAAAGCGCGAATGATAGGGATTTGTGGGCCTTCTGAAACTGGTAAGACTACTATAGGAAGAGCTTTATACAGCAGACTCAAAAGCGACTTCCACCATCGGGCTTTCGTAGCATATAAGAGAAAAATACGGAGCGACTATGACCAGAAGCTGTATTGGGAAGAACAATTTCTATCAGAAATTCTTTGTCAGAAGGATATAAAGATAGAGGAATGTGGTGCGGTGGAACAACGACTAAAGCACACGAAAGTTCTTATTGTTCTTGATGATGTTGATGATATAGAGCTACTAAAAACGTTGGTAGGACGTATCAGATGGTTTGGATCTGAGAGCAAAATTGTTGTGATTACTCAAAAAAGGGAACTTCTCAAGGCTCACAACATTGCACATGTTTATGAAGTGGGATTCCCATCAGAAGAACTGGCTCATCAAATGTTTTGTCGATATGCTTTTGGGAAAAACTCTCCACCTCATGGTTTCAACGAGCTTGCAGATGAAGCTGCAAAGATTGCCGGTAATCGTCCTAAAGCTCTCAAGTACGTTGGTTCGTCTTTTAGAAGACTAGACAAGGAACAATGGGTGAAGATGCTATCGGAGTTCCGTAGTAATGGGAATAAACTAAAAATCAGCTATGATGAGTTAGATGGTAAAGGTCAAGATTACGTTGCGTGTTTAACCAATGGTTCAAATTCCCAGGTGAAGGCAGAGTGGATCCACTTGGCACTAGGCGTGTCTATATTACTTAACATCCGCAGTGACGGAACGACAATTCTCAAACATTTGAGCTACAATCGAAGCATGGCGCAACAAGCAAAAATATGGTGGTATGAAAATTTGGAAAGAGTGTGCAAGAAGTACAATATATGTGGCATAGATAGCTCAACTGATGGTGGTGGTTCAACGTATGGACAATGTTCAAATTCCCAATTTCAAAGAAACATGGACGCAAGCCCCGGGGGAAACAAAACCAGTAATCAATCCACAAAAGATTCACCGAGAGCTTCTCAAGTAGAGAAGGAAAAGATCGAGTACTGTGAGCCACATGTATATATAACACCTGCCATCTTCAGTGACGGAACCAGAGCTCCCAAATACGTGGAGTCTAGTAGCCGAAGAGTAACCCAAGTGCACCACGCCAAAACATGGTGGCCGGAGAATTGTGAAAAAGTGTACGAGAACCACAACAACATATATGGCATAGATAGATCAATTGACGGTGGTGATAAGTTTGAGGGAAAAAGTAAAGTTAGTGACGGTGGGTTAGACGGCAAAGATCAAGGTTCAATGTATGGACAAAGTTCAAATTCCGAGCTTCAAATAAACATGGACGCAGACAATAGGAGATGTGAACCTGTGAGTGAGATGCTTTTCAAAAATTACAATGTGTGTTCGCCTAATGGTTTAACCGATGTAAACTGTTCAAATCCCCAGTCTCAAAGAAAATTGGACGCAAGCCTAAAGAAAGACAAAATTGTGCATGAGTGGATTCGAACCGGTAGTGGCTTCTTTTTTGATTTTCAGGGCCCAAAATCTATAGTGAGTGCTGCTCAAGTGGACGAGAAAAATTTCGAGTACTGTGAACAAGGTGTGTATATAACACTTGGCATCCTCAGTGGCGGAATTATAGTTCTCAAACATTTGGAGTTCAGCCGAAGAATGGCGCAACAAGCAAAAGTTTGGTGGTCGGAAAATTGGATAAAAGTGTACCAGGAGCACAACATATGTGGCATAGATAAATCATTTGATGGTAGGTTTGATGATAGACGTGTCATTCGTCAATTAAGACCAAACTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MLENIAKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDELDGKGQDYVACLTNGSNSQVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYNICGIDSSTDGGGSTYGQCSNSQFQRNMDASPGGNKTSNQSTKDSPRASQVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
6-240 SSF52540

AKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSE

Gene3D: G3DSA:3.40.50.300
15-166 G3DSA:3.40.50.300

PPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKA

HMMPfam: PF00931
IPR002182
27-255 NB-ARC,NBS
NB-ARC

EAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDEL

FPrintScan: PR00364
IPR000767
46-61 DISEASERSIST
Disease resistance protein

MIGICGPSETGKTTIG

FPrintScan: PR00364
IPR000767
119-133 DISEASERSIST
Disease resistance protein

RLKHTKVLIVLDDVD

FPrintScan: PR00364
IPR000767
212-226 DISEASERSIST
Disease resistance protein

AGNRPKALKYVGSSF

HMMPfam: PF08381
IPR013591
273-328 BRX
Brevis radix-like domain

QVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

ProfileScan: PS51514
IPR013591
276-328 BRX
Brevis radix-like domain

AEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

HMMPfam: PF08381
IPR013591
377-436 BRX
Brevis radix-like domain

QVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHN

HMMPanther: PTHR22870:SF61
378-638 PTHR22870:SF61,DISEASE RESISTANCE PROTEIN (TIR-NBS CLASS)

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

HMMPanther: PTHR22870
378-638 PTHR22870,REGULATOR OF CHROMOSOME CONDENSATION

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

ProfileScan: PS51514
IPR013591
380-436 BRX
Brevis radix-like domain

KEKIEYCEPHVYITPAIFSDGTRAPKYVESSSRRVTQVHHAKTWWPENCEKVYENHN

HMMPfam: PF08381
IPR013591
559-614 BRX
Brevis radix-like domain

VDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHN

ProfileScan: PS51514
IPR013591
561-614 BRX
Brevis radix-like domain

EKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox