PRGDB00046973 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42573595 (NM_203165)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT5G46490) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCATCTTCTTCTCGAAATTGGTTATATGATGTTTTCTTGAGCTTCAGAGGGGGAGACGTCCGTGTAACATTCCGTAGCCACTTTCTCAAGGAGTTCGATCGGAAACTGATCACTGCTTTCAGAGACAATGAGATCGAGAGAAGCCACTCTCTTTGGCCCGATCTTGAACAAGCGATCAAGGACTCCAGAATCGCAGTGGTCGTTTTCTCCAAAAACTACGCTTCATCGAGCTGGTGTCTTAACGAGTTGCTGGAGATTGTGAACTGCAATGATAAAATTATCATACCGGTTTTCTACGGTGTGGATCCTTCCCAAGTGAGGTATCAAATCGGTGACTTTGGAAGGATCTTTGAAAAGACTTGCAAGAGACAAACAGAGGAAGTGAAAAACCAATGGAAGAAAGCGTTGACTCTTGTAGCTAATATGCTTGGATTTGATTCTGCCAAATGGGATGACGAAGCAAAAATGATTGAAGAAATAGCCAATGATGTTTTGCGTAAACTGCTTTTAACTACATCGAAGGATTTTGATGACTTTGTCGGCCTCGAGGATCATATTGCAAATATGAGTGCACTGTTGGATCTGGAATCTAAGGAAGTGAAGATGGTTGGTATATGGGGTTCCTCGGGGATTGGTAAGACTACCATTGCACGAGCTTTGTTTAACAACCTTTTTCGGCATTTCCAAGTTAGGAAATTCATAGACAGATCTTTTGCCTATAAGAGTAGAGAAATTCATAGTAGTGCCAATCCTGACGACCACAATATGAAGTTACATTTACAAGAGAGCTTCCTCTCTGAAATTCTAAGGATGCCGAACATAAAGATAGATGATCCAACTGCACTGGAAGAGAGGCTAAAGTACCAAAAAGTTCTTATCATTATTGATGATTTGGATGATATAATGGTACTAGATACATTGGTGGGTCAAACTCAATGGTTTGGATATGGGAGCAGAATCATTGTGGTTACAAATGATAAGCACTTCTTGACTGCTCATGGGATTGATCATATTTATGAAGTTAGTTTCCCAACTGACGTGCATGCTTGTCAGATGTTATGTCAATCTGCATTCAAGCAAAACTATGCTCCTGAAGGTTTTGGGGATCTTGTAGTTGATGTTGTAAGACATGCATGTAGTTTTCCTTTGGGTCTTAATCTTTTGGGTAAGTATCTGCGGGGTAGGAATGAGGAGTACTGGATGGATATACTGCCAAGGCTTGAGAATGGTTTACGTCTAGACGGTAAAATTGAGAAAATACTAAGAATCAGCTATGATGGGTTAGATAGTGAAGATCAAGAGATATTTCGTCATATCGCATGTATTTTCATTCATATGAAAGTCACAACCATCAAGTCCTTGCTGGCAGAGAGTGATGTTAGTTTTGCACTGGAAAACCTAGCTGATAAGTCTCTCATTCATGTCAGACAAGGTTATGTGGTGATGCACCGTTCGCTACAAGAAATGGGTAGAAAAATTGTTCGCATTCAGTCCATTGACAATCCTGGAGAGCGAGAATTTTTGGTGGATCCAAATGATATACATGATGTACTCAATGCATGCACAGGTACTCAAAAGGTTTTAGGTATATCACTCAATACAAGAAATATTGTTGAGTTGGATGTACATGAGAGTGCCATCAAAGGGATGTCTAATCTCCGTTTCTTAGAAATTAAGGATTTCATAAGTCAATGGAAGAAAGCGTTGATTGATGTATCTAAGATAGCATTTGATTCTACCGAATGGAATCGCGGATTAATCACTCAAAATTATGTTAATTTGCTTTTGCTTTCAACTACTCCCAAGGAGTATGAGGAACTTGTTGGCATTGAAGATCACACCGCTGAAATGAGTTTACCTGCAACTAAGAGCTTTGATTTCGAAGATGACGGATTGCATTTACCTGCAAGTTTCGACTATTTGCCTCCTACACTTAAACTATTGTGCTGGCCCAAATTTCCAATGAGGTGTATGCCTTATGATTTTTGTCCTGAAAACCTTGTCAAACTCGAAATGCGGGAGAGCAAGCTATATAAGCTGTGGGAAGGAGTTGTGCCACTTACATGTCTAAAGGAAATGGATCTAGATGGATCAGTCAATCTGAAAGAAATTCCAGATCTTTCCATGGCTACTAATCTCGAGACACTTAATTTTGAGAATTGCAAGAGTTTGGTGGAGCTTCCTTCCTTTATACGAAATCTCAATAAGCTGTTGAAATTGAACATGGCATTCTGCAACAGTCTGGAAACTCTTCCAACTGGTTTCAACCTCAAATCTCTGGACCGCCTTAGTTTCTCTGAATGCACAAAGTTGAAGACTTTTCCCAAATTCTCAACCAACATCTCAGTTCTCAATCTCTTTGGAACAAACATTGAAGAATACCCTTCTCACTTACATCTCGAGAATCTTGTCGAGTTTAGCATATCAAAAGAAGAGAGTAATATGATACAATGGGAGGGAGCGAAGGTGAGTAGTTCTAAACTTAATATTCTCTCCAAACTATTTTACTATCACTGTTTATATTTAAACTATTGTCGCAGACTCAAATTTTGTACACTTGTGTATTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MASSSSSRNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANMLGFDSAKWDDEAKMIEEIANDVLRKLLLTTSKDFDDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDDPTALEERLKYQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPEGFGDLVVDVVRHACSFPLGLNLLGKYLRGRNEEYWMDILPRLENGLRLDGKIEKILRISYDGLDSEDQEIFRHIACIFIHMKVTTIKSLLAESDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDNPGEREFLVDPNDIHDVLNACTGTQKVLGISLNTRNIVELDVHESAIKGMSNLRFLEIKDFISQWKKALIDVSKIAFDSTEWNRGLITQNYVNLLLLSTTPKEYEELVGIEDHTAEMSLPATKSFDFEDDGLHLPASFDYLPPTLKLLCWPKFPMRCMPYDFCPENLVKLEMRESKLYKLWEGVVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIRNLNKLLKLNMAFCNSLETLPTGFNLKSLDRLSFSECTKLKTFPKFSTNISVLNLFGTNIEEYPSHLHLENLVEFSISKEESNMIQWEGAKVSSSKLNILSKLFYYHCLYLNYCRRLKFCTLVY

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSRNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANMLGF

Gene3D: G3DSA:3.40.50.10140
7-145 G3DSA:3.40.50.10140

SRNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANM

ProfileScan: PS50104
IPR000157
10-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANM

HMMSmart: SM00255
IPR000157
11-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANM

HMMPfam: PF01582
IPR000157
14-139 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKAL

HMMPanther: PTHR11017:SF20
31-852 PTHR11017:SF20,SUBFAMILY NOT NAMED

FLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANMLGFDSAKWDDEAKMIEEIANDVLRKLLLTTSKDFDDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDDPTALEERLKYQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPEGFGDLVVDVVRHACSFPLGLNLLGKYLRGRNEEYWMDILPRLENGLRLDGKIEKILRISYDGLDSEDQEIFRHIACIFIHMKVTTIKSLLAESDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDNPGEREFLVDPNDIHDVLNACTGTQKVLGISLNTRNIVELDVHESAIKGMSNLRFLEIKDFISQWKKALIDVSKIAFDSTEWNRGLITQNYVNLLLLSTTPKEYEELVGIEDHTAEMSLPATKSFDFEDDGLHLPASFDYLPPTLKLLCWPKFPMRCMPYDFCPENLVKLEMRESKLYKLWEGVVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIRNLNKLLKLNMAFCNSLETLPTGFNLKSLDRLSFSECTKLKTFPKFSTNISVLNLFGTNIEEYPSHLHLENLVEFSISKEESNMIQWEGAKVSSSKLNILSKLFYYHCLYLNYCRRLK

HMMPanther: PTHR11017
31-852 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLKEFDRKLITAFRDNEIERSHSLWPDLEQAIKDSRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANMLGFDSAKWDDEAKMIEEIANDVLRKLLLTTSKDFDDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDDPTALEERLKYQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPEGFGDLVVDVVRHACSFPLGLNLLGKYLRGRNEEYWMDILPRLENGLRLDGKIEKILRISYDGLDSEDQEIFRHIACIFIHMKVTTIKSLLAESDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDNPGEREFLVDPNDIHDVLNACTGTQKVLGISLNTRNIVELDVHESAIKGMSNLRFLEIKDFISQWKKALIDVSKIAFDSTEWNRGLITQNYVNLLLLSTTPKEYEELVGIEDHTAEMSLPATKSFDFEDDGLHLPASFDYLPPTLKLLCWPKFPMRCMPYDFCPENLVKLEMRESKLYKLWEGVVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIRNLNKLLKLNMAFCNSLETLPTGFNLKSLDRLSFSECTKLKTFPKFSTNISVLNLFGTNIEEYPSHLHLENLVEFSISKEESNMIQWEGAKVSSSKLNILSKLFYYHCLYLNYCRRLK

superfamily: SSF52540
65-440 SSF52540

SRIAVVVFSKNYASSSWCLNELLEIVNCNDKIIIPVFYGVDPSQVRYQIGDFGRIFEKTCKRQTEEVKNQWKKALTLVANMLGFDSAKWDDEAKMIEEIANDVLRKLLLTTSKDFDDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDDPTALEERLKYQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPEGFGDLVVDVVRHACSFPLGLNLLGKYLRGRNEEYWMDILPRLENGLRLDGKIEKILRISYDGLDSEDQEIFR

Gene3D: G3DSA:3.40.50.300
178-334 G3DSA:3.40.50.300

DFDDFVGLEDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDDPTALEERLKYQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLT

HMMPfam: PF00931
IPR002182
186-453 NB-ARC,NBS
NB-ARC

EDHIANMSALLDLESKEVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDDPTALEERLKYQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPTDVHACQMLCQSAFKQNYAPEGFGDLVVDVVRHACSFPLGLNLLGKYLRGRNEEYWMDILPRLENGLRLDGKIEKILRISYDGLDSEDQEIFRHIACIFIHMKVTT

HMMSmart: SM00382
IPR003593
202-348 AAA,NBS
AAA+ ATPase domain

EVKMVGIWGSSGIGKTTIARALFNNLFRHFQVRKFIDRSFAYKSREIHSSANPDDHNMKLHLQESFLSEILRMPNIKIDDPTALEERLKYQKVLIIIDDLDDIMVLDTLVGQTQWFGYGSRIIVVTNDKHFLTAHGIDHIYEVSFPT

FPrintScan: PR00364
IPR000767
205-220 DISEASERSIST
Disease resistance protein

MVGIWGSSGIGKTTIA

FPrintScan: PR00364
IPR000767
288-302 DISEASERSIST
Disease resistance protein

RLKYQKVLIIIDDLD

FPrintScan: PR00364
IPR000767
381-395 DISEASERSIST
Disease resistance protein

ACSFPLGLNLLGKYL

superfamily: SSF46785
418-522 SSF46785

GKIEKILRISYDGLDSEDQEIFRHIACIFIHMKVTTIKSLLAESDVSFALENLADKSLIHVRQGYVVMHRSLQEMGRKIVRIQSIDNPGEREFLVDPNDIHDVLN

Gene3D: G3DSA:3.40.50.300
467-495 G3DSA:3.40.50.300

LENLADKSLIHVRQGYVVMHRSLQEMGRK

superfamily: SSF52058
574-812 SSF52058,LRR

DVSKIAFDSTEWNRGLITQNYVNLLLLSTTPKEYEELVGIEDHTAEMSLPATKSFDFEDDGLHLPASFDYLPPTLKLLCWPKFPMRCMPYDFCPENLVKLEMRESKLYKLWEGVVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIRNLNKLLKLNMAFCNSLETLPTGFNLKSLDRLSFSECTKLKTFPKFSTNISVLNLFGTNIEEYPSHLHLENLVEFSIS

Gene3D: G3DSA:3.80.10.10
636-827 G3DSA:3.80.10.10

HLPASFDYLPPTLKLLCWPKFPMRCMPYDFCPENLVKLEMRESKLYKLWEGVVPLTCLKEMDLDGSVNLKEIPDLSMATNLETLNFENCKSLVELPSFIRNLNKLLKLNMAFCNSLETLPTGFNLKSLDRLSFSECTKLKTFPKFSTNISVLNLFGTNIEEYPSHLHLENLVEFSISKEESNMIQWEGAKVS

HMMPfam: PF07725
IPR011713
669-687 LRR_3
Leucine-rich repeat 3

NLVKLEMRESKLYKLWEGV

FPrintScan: PR00364
IPR000767
735-751 DISEASERSIST
Disease resistance protein

RNLNKLLKLNMAFCNSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox