PRGDB00046977 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30696889 (NM_105051)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G63740) mRNA, complete cds.

DNA Sequence

ATGTTCGATGATCAAGCAATCGAAAGAGGCCAAACCATTTCCCCTGAACTCACACGAGGGATTAGGGAATCGAGGATCTCGATCGTAGTGCTCTCGAAGAACTATGCTTCATCGAGCTGGTGTTTGGATGAGCTGTTGGAGATTTTGAAATGCAAGGAAGATATTGGGCAAATAGTGATGACTGTCTTCTACGGAGTAGATCCATCTGATGTGCGCAAACAAACCGGAGATATCTTGAAAGTTTTCAAGAAAACTTGTTCTGGTAAAACGGAGGAGAAGAGGCGAAGATGGAGCCAAGCTTTGAACGATGTTGGCAACATTGCCGGAGAACATTTCCTTAACTGGGATAATGAATCGAAGATGATGGAGAAGATTGCAAGAGATATTTCAAACAAAGTAAACACTACAATCTCTAGGGATTTTGAAGACATGGTGGGAGTTGAGACACACCTGGAGAAAATACAGTCTTTGTTACATTTAGATAATGATGATGAAGCTATGATTGTTGGAATCTATGGCCCTGCAGGTATTGGTAAGACTACCATTGCCAGAGCTTTGCACAGTCTACTCTCTGATAGGTTTCAGCTTACTTGTTTTATGGAGAATCTTAGGGGAAGCTATAATAGTAGTCTTGACGAGTATGGTTTGAAGCTGCAATTACAAGAACAACTTCTTTCCAAGATTTTAAACCAAACTGGTATGAGGGTATACAATTTAAGTGCAATACAGGGAATGCTATGCGACCAAAAAGTGCTTATCATTCTTGATGATGTGGACGATCTGAAGCAACTAGAAGCTTTGGCTAATGAAACTAAGTGGTTTGGTCCTGGGAGTAGGGTTGTAGTGACCACAGAAAATCAAGAGCTTTTGAAGCAACATGACGATATTAAGAATACATACTATGTGGATTTTCCTACTCAGAAAGAAGCTCGTCAGATCTTTTGTAGATATGGTTTTAAACAGAGCACTCCACAAGATGGTTTCGAAAATCTTTCCGAAAGAGTTATAAAGCTTTGCAGCAAACTTCCACTAGGTCTTAGTGTCATGGGTTTATATCTACGAAAAAAGACAGAAGATGACTGGGAAGATATACTGCATAGGCTAGAAAGTAGCTTTGATTCAGTTGATCGAAATATCGAGAGAGTACTAAGAGTCGGATATGACGGTTTACATGAGAAGGATCAATTGTTATTTCTCCTCATTGCATTCTTCTTCAACTACAAAGACGATGATCATGTGAAAGCAATGCTTGCTGACAATAACTTGAATGTCAGACTCGGTTTGAAAACTCTCGAGTATAAATCTCTTATACAAAGATCGTCTGGAGGAAATATAGTGATGCACAAGTTACTACAACAAGTGGGTAGAGAAGCGGTTCAAAGACAAGAGCCTTGGAAACGCCAAATCTTAATTGATGCTCATGAGATTTGTAATGTCCTCGAAACTGATTCTGGTTGTGCAAATGTGATGGGCATATCCTTTAATGTATCTACAATCCCGAATGGCGTGCATATAAGCGCAAAAGCTTTTCAAAATATGCGTAATCTTCGATTTCTAAGCATCTACGAGACAAGACGTGATGTAAACCTTAGAGTAAATGTACCCGATGACATGGATTTCCCACATCGTCTAAGGTCTTTACATTGGGAGGTATACCCAGGAAAGTCTCTTCCTTCTACATTTAGGCCAGAATATCTTGTGGAACTCAACTTGCAAAATAACAAGCTAGAGAAGCTTTGGGAAGGAACCCAGCCTCTTACAAATCTCAACAAGTTGGAATTGTGTGGGTCCTTGAGATTGAAGGAACTTCCAGATCTTTCAAGTGCTACAAATCTCAAGAGACTAGATCTAACTGGTTGTTGGAGTTTGGTAGAGATTCCTTCCTCTGTTGGAAATCTTCACAAACTAGAAGAGTTGGAGATGAATTTATGTTTACAGCTACAAGTTGTTCCGACTCACTTCAACTTGGCATCTCTTAGATCACTCAGGATGTTGGGATGCTGGGAATTAAGGAAATTTCCAGGTATTTCTACGAACATCACATCCCTCGTAATCGGAGATGCAATGTTAGAAGAAATGCTTGAATCAATTAGGCTTTGGTCTTGCCTTGAGACTCTGGTTGTATATGGCAGTGTCATTACACATAATTTTTGGGCAGTAACTTTAATAGAGAAAATGGGCACAGATATAGAGAGGATTCCTGATTGCATCAAAGATCTCCCTGCGTTAAAATCGCTTTATATAGGTGGCTGTCCAAAACTTTTTTCACTGCCAGAGCTCCCTGGCTCACTCAGAAGACTAACGGTAGAAACTTGTGAATCACTCAAGACTGTATCTTTTCCTATTGATTCTCCAATTGTGAGTTTCAGTTTCCCCAACTGCTTCGAATTGGGTGAAGAAGCACGGAGAGTGATTACACAGAAAGCAGGTCAGATGATAGCATACTTACCAGGAAGGGAAATACCTGCGGAGTTCGTGCACAGAGCTATAGGAGATTCGTTGACCATCCGTTCATCTTTCTGCTCCATATTTAGGATTTGCGTTGTGGTTTCCCCTAAATCAGAGATGAAAGAAGAATATGTTGGTTTTATGTGTCGCAAACGCATAAACGGTTGCCCCATTGGCGATAACTTATTTAAGGCACAGCTCCGTAAACTCCAAGCGGAACATCTATTTATATTTCAATTTGAATTCCTTGAGGAAGACGGATGGCTGGAACAGGACAACGAGGTATTGTTCAAATTCACGACCTCATCCGAGGAACTAGACATTATTGAATGTGGTATCCAGATATTGACAGGCGAAACCAACAGAAACATAAGCACCTATGGAAGCTATGAATCCAGATCAGAGCAAGTCTCTGAATACGAAGATGGATATCACTCTGATAGGAGACTTGAGTTCCACGAACAAAAGTCCTTGCCCGGGTGGGGTTTCTGTGGAATTTTTCATGGCTTCTTGAGATGTTTTATGGTCTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MFDDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALNDVGNIAGEHFLNWDNESKMMEKIARDISNKVNTTISRDFEDMVGVETHLEKIQSLLHLDNDDEAMIVGIYGPAGIGKTTIARALHSLLSDRFQLTCFMENLRGSYNSSLDEYGLKLQLQEQLLSKILNQTGMRVYNLSAIQGMLCDQKVLIILDDVDDLKQLEALANETKWFGPGSRVVVTTENQELLKQHDDIKNTYYVDFPTQKEARQIFCRYGFKQSTPQDGFENLSERVIKLCSKLPLGLSVMGLYLRKKTEDDWEDILHRLESSFDSVDRNIERVLRVGYDGLHEKDQLLFLLIAFFFNYKDDDHVKAMLADNNLNVRLGLKTLEYKSLIQRSSGGNIVMHKLLQQVGREAVQRQEPWKRQILIDAHEICNVLETDSGCANVMGISFNVSTIPNGVHISAKAFQNMRNLRFLSIYETRRDVNLRVNVPDDMDFPHRLRSLHWEVYPGKSLPSTFRPEYLVELNLQNNKLEKLWEGTQPLTNLNKLELCGSLRLKELPDLSSATNLKRLDLTGCWSLVEIPSSVGNLHKLEELEMNLCLQLQVVPTHFNLASLRSLRMLGCWELRKFPGISTNITSLVIGDAMLEEMLESIRLWSCLETLVVYGSVITHNFWAVTLIEKMGTDIERIPDCIKDLPALKSLYIGGCPKLFSLPELPGSLRRLTVETCESLKTVSFPIDSPIVSFSFPNCFELGEEARRVITQKAGQMIAYLPGREIPAEFVHRAIGDSLTIRSSFCSIFRICVVVSPKSEMKEEYVGFMCRKRINGCPIGDNLFKAQLRKLQAEHLFIFQFEFLEEDGWLEQDNEVLFKFTTSSEELDIIECGIQILTGETNRNISTYGSYESRSEQVSEYEDGYHSDRRLEFHEQKSLPGWGFCGIFHGFLRCFMV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-970 PTHR11017:SF20,SUBFAMILY NOT NAMED

MFDDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALNDVGNIAGEHFLNWDNESKMMEKIARDISNKVNTTISRDFEDMVGVETHLEKIQSLLHLDNDDEAMIVGIYGPAGIGKTTIARALHSLLSDRFQLTCFMENLRGSYNSSLDEYGLKLQLQEQLLSKILNQTGMRVYNLSAIQGMLCDQKVLIILDDVDDLKQLEALANETKWFGPGSRVVVTTENQELLKQHDDIKNTYYVDFPTQKEARQIFCRYGFKQSTPQDGFENLSERVIKLCSKLPLGLSVMGLYLRKKTEDDWEDILHRLESSFDSVDRNIERVLRVGYDGLHEKDQLLFLLIAFFFNYKDDDHVKAMLADNNLNVRLGLKTLEYKSLIQRSSGGNIVMHKLLQQVGREAVQRQEPWKRQILIDAHEICNVLETDSGCANVMGISFNVSTIPNGVHISAKAFQNMRNLRFLSIYETRRDVNLRVNVPDDMDFPHRLRSLHWEVYPGKSLPSTFRPEYLVELNLQNNKLEKLWEGTQPLTNLNKLELCGSLRLKELPDLSSATNLKRLDLTGCWSLVEIPSSVGNLHKLEELEMNLCLQLQVVPTHFNLASLRSLRMLGCWELRKFPGISTNITSLVIGDAMLEEMLESIRLWSCLETLVVYGSVITHNFWAVTLIEKMGTDIERIPDCIKDLPALKSLYIGGCPKLFSLPELPGSLRRLTVETCESLKTVSFPIDSPIVSFSFPNCFELGEEARRVITQKAGQMIAYLPGREIPAEFVHRAIGDSLTIRSSFCSIFRICVVVSPKSEMKEEYVGFMCRKRINGCPIGDNLFKAQLRKLQAEHLFIFQFEFLEEDGWLEQDNEVLFKFTTSSEELDIIECGIQILTGETNRNISTYGSYESRSEQVSEYEDGYHSDRRLEFHE

HMMSmart: SM00255
IPR000157
1-107 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MFDDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALNDVGNI

ProfileScan: PS50104
IPR000157
1-107 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MFDDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALNDVGNI

HMMPanther: PTHR11017
1-970 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MFDDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALNDVGNIAGEHFLNWDNESKMMEKIARDISNKVNTTISRDFEDMVGVETHLEKIQSLLHLDNDDEAMIVGIYGPAGIGKTTIARALHSLLSDRFQLTCFMENLRGSYNSSLDEYGLKLQLQEQLLSKILNQTGMRVYNLSAIQGMLCDQKVLIILDDVDDLKQLEALANETKWFGPGSRVVVTTENQELLKQHDDIKNTYYVDFPTQKEARQIFCRYGFKQSTPQDGFENLSERVIKLCSKLPLGLSVMGLYLRKKTEDDWEDILHRLESSFDSVDRNIERVLRVGYDGLHEKDQLLFLLIAFFFNYKDDDHVKAMLADNNLNVRLGLKTLEYKSLIQRSSGGNIVMHKLLQQVGREAVQRQEPWKRQILIDAHEICNVLETDSGCANVMGISFNVSTIPNGVHISAKAFQNMRNLRFLSIYETRRDVNLRVNVPDDMDFPHRLRSLHWEVYPGKSLPSTFRPEYLVELNLQNNKLEKLWEGTQPLTNLNKLELCGSLRLKELPDLSSATNLKRLDLTGCWSLVEIPSSVGNLHKLEELEMNLCLQLQVVPTHFNLASLRSLRMLGCWELRKFPGISTNITSLVIGDAMLEEMLESIRLWSCLETLVVYGSVITHNFWAVTLIEKMGTDIERIPDCIKDLPALKSLYIGGCPKLFSLPELPGSLRRLTVETCESLKTVSFPIDSPIVSFSFPNCFELGEEARRVITQKAGQMIAYLPGREIPAEFVHRAIGDSLTIRSSFCSIFRICVVVSPKSEMKEEYVGFMCRKRINGCPIGDNLFKAQLRKLQAEHLFIFQFEFLEEDGWLEQDNEVLFKFTTSSEELDIIECGIQILTGETNRNISTYGSYESRSEQVSEYEDGYHSDRRLEFHE

Gene3D: G3DSA:3.40.50.10140
2-104 G3DSA:3.40.50.10140

FDDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALNDV

HMMPfam: PF01582
IPR000157
3-102 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALN

superfamily: SSF52540
24-399 SSF52540

SRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGDILKVFKKTCSGKTEEKRRRWSQALNDVGNIAGEHFLNWDNESKMMEKIARDISNKVNTTISRDFEDMVGVETHLEKIQSLLHLDNDDEAMIVGIYGPAGIGKTTIARALHSLLSDRFQLTCFMENLRGSYNSSLDEYGLKLQLQEQLLSKILNQTGMRVYNLSAIQGMLCDQKVLIILDDVDDLKQLEALANETKWFGPGSRVVVTTENQELLKQHDDIKNTYYVDFPTQKEARQIFCRYGFKQSTPQDGFENLSERVIKLCSKLPLGLSVMGLYLRKKTEDDWEDILHRLESSFDSVDRNIERVLRVGYDGLHEKDQLLFL

Gene3D: G3DSA:3.40.50.300
120-180 G3DSA:3.40.50.300

KMMEKIARDISNKVNTTISRDFEDMVGVETHLEKIQSLLHLDNDDEAMIVGIYGPAGIGKT

HMMPfam: PF00931
IPR002182
148-409 NB-ARC,NBS
NB-ARC

ETHLEKIQSLLHLDNDDEAMIVGIYGPAGIGKTTIARALHSLLSDRFQLTCFMENLRGSYNSSLDEYGLKLQLQEQLLSKILNQTGMRVYNLSAIQGMLCDQKVLIILDDVDDLKQLEALANETKWFGPGSRVVVTTENQELLKQHDDIKNTYYVDFPTQKEARQIFCRYGFKQSTPQDGFENLSERVIKLCSKLPLGLSVMGLYLRKKTEDDWEDILHRLESSFDSVDRNIERVLRVGYDGLHEKDQLLFLLIAFFFNYKD

HMMSmart: SM00382
IPR003593
165-314 AAA,NBS
AAA+ ATPase domain

EAMIVGIYGPAGIGKTTIARALHSLLSDRFQLTCFMENLRGSYNSSLDEYGLKLQLQEQLLSKILNQTGMRVYNLSAIQGMLCDQKVLIILDDVDDLKQLEALANETKWFGPGSRVVVTTENQELLKQHDDIKNTYYVDFPTQKEARQIF

FPrintScan: PR00364
IPR000767
168-183 DISEASERSIST
Disease resistance protein

IVGIYGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
181-195 G3DSA:3.40.50.300

TIARALHSLLSDRFQ

Gene3D: G3DSA:3.40.50.300
236-373 G3DSA:3.40.50.300

VYNLSAIQGMLCDQKVLIILDDVDDLKQLEALANETKWFGPGSRVVVTTENQELLKQHDDIKNTYYVDFPTQKEARQIFCRYGFKQSTPQDGFENLSERVIKLCSKLPLGLSVMGLYLRKKTEDDWEDILHRLESSFD

FPrintScan: PR00364
IPR000767
245-259 DISEASERSIST
Disease resistance protein

MLCDQKVLIILDDVD

FPrintScan: PR00364
IPR000767
339-353 DISEASERSIST
Disease resistance protein

CSKLPLGLSVMGLYL

superfamily: SSF46785
377-481 SSF46785

RNIERVLRVGYDGLHEKDQLLFLLIAFFFNYKDDDHVKAMLADNNLNVRLGLKTLEYKSLIQRSSGGNIVMHKLLQQVGREAVQRQEPWKRQILIDAHEICNVLE

superfamily: SSF52058
501-813 SSF52058,LRR

NGVHISAKAFQNMRNLRFLSIYETRRDVNLRVNVPDDMDFPHRLRSLHWEVYPGKSLPSTFRPEYLVELNLQNNKLEKLWEGTQPLTNLNKLELCGSLRLKELPDLSSATNLKRLDLTGCWSLVEIPSSVGNLHKLEELEMNLCLQLQVVPTHFNLASLRSLRMLGCWELRKFPGISTNITSLVIGDAMLEEMLESIRLWSCLETLVVYGSVITHNFWAVTLIEKMGTDIERIPDCIKDLPALKSLYIGGCPKLFSLPELPGSLRRLTVETCESLKTVSFPIDSPIVSFSFPNCFELGEEARRVITQKAGQMI

Gene3D: G3DSA:3.80.10.10
503-773 G3DSA:3.80.10.10

VHISAKAFQNMRNLRFLSIYETRRDVNLRVNVPDDMDFPHRLRSLHWEVYPGKSLPSTFRPEYLVELNLQNNKLEKLWEGTQPLTNLNKLELCGSLRLKELPDLSSATNLKRLDLTGCWSLVEIPSSVGNLHKLEELEMNLCLQLQVVPTHFNLASLRSLRMLGCWELRKFPGISTNITSLVIGDAMLEEMLESIRLWSCLETLVVYGSVITHNFWAVTLIEKMGTDIERIPDCIKDLPALKSLYIGGCPKLFSLPELPGSLRRLTVETCE

HMMPfam: PF07725
IPR011713
565-584 LRR_3
Leucine-rich repeat 3

YLVELNLQNNKLEKLWEGTQ

FPrintScan: PR00364
IPR000767
607-623 DISEASERSIST
Disease resistance protein

SSATNLKRLDLTGCWSL

HMMPfam: PF00560
IPR001611
611-633 LRR_1
Leucine-rich repeat

NLKRLDLTGCWSLVEIPSSVGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox