PRGDB00046978 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30693880 (NM_123539)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G41740) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCATCTTCTTCGTCTCACATAAGGAGACACCATGTCTTTTCGCGCTTCCACGGTCCAGATGTCCGTAAAGGGTTTCTCAGTCATTTACACAGTCTCTTTGCAAGCAAAGGTATCACGACTTTCAATGATCAGAATATCGAGAGAGGCCAGACGATCGGACCTGAGCTCATACAAGGGATTAAAGAAGCTAGAGTCTCGATCGTTGTGCTCTCGAAGAATTACGCTTCTTCCAGCTGGTGTTTAGATGAACTTGTGGAAATCTTGAAGTGCAAAGAAGCTTTGGGGCAGATTGTGATGACGAGTGGAGTGTTCGGGAAAGCTTTTGAGAAGACTTGTCAAGGGAAAAATGAGGAGGTGAAGATCCGATGGAGAAATGCTTTGGCACATGTCGCTACCATTGCTGGGGAACACTCTCTTAATTGGGATAATGAAGCAAAGATGATCCAAAAGATTGCTACAGATGTTTCAGACAAACTGAATCTCACACCGTCGAGGGATTTTGAGGGGATGGTAGGGATGGAAGCTCACTTGAAAAGATTGAACTCTTTGTTATGCCTGGAAAGTGATGAAGTCAAGATGATTGGAATTTGGGGTCCAGCGGGAATTGGTAAGACTACCATTGCTAGAGCTTTATTCGACGACAGACTCTCTAGCAGTTTTCAACATAAATGTTTTATGGGGAACCTCAAGGGAAGTATTAAGGGTGTTGCTGACCATGATTCCAAGTTGAGGTTGCAAAAGCAACTTCTGTCTAAGATTTTTAAGGAAGAGAATATGAAGATACATCATTTAGGCGCAATACGAGAAAGGCTACACGATCAAAGAGTGCTCATCATTCTTGACGATGTAGATGATCTAAAGCAATTAGAGGTATTGGCTAAAGAAATCTCTTGGTTTGGTTCTGGAAGCCGAATCATCGGTACCACAGAAGATAAGAAGATTTTGAAGGCACATGGGATTCACAATATCTACCGTGTGGATTTTCCATCGAAGAAAGACGCTCTTGAGATCTTATGTCTCTCTGCATTCAAACAAAGCTCTATACCAGATGGTTTTGAAGAGCTTGCCAATAAAGTAGCTAAGCTTTGCAGCAACCTTCCATTAGGCCTTTGTGTCGTGGGTGCATCTTTGCGTGGGGAGGGCAATCAAGAGTGGGAACGTCTATTATCTAGGATCGAATCTAGTCTTGATAGGGATATCGATGACATATTACGAATCGGATATGACAGATTGTTGACGAATGATAAATCTCTATTCCTTCACATTGCATGCTTCTTCAACTATGCAAAGGTTGATAATGTGACAGCCTTGTTAGCTGACAGTAACTTGGATGTTGGAAATGGTTTCAATACCCTAGCCGATAGATCTCTCGTGCGTATATCTACCTATGATGATGGGATATCTGTGCTTTCTGATAGTAACTTGGATATAGTTCTTGAACAGTCTAAGGAGCCCGGGAAACGTGAATTTATAATTGAGCCAGAAGAGATTCGTGATGTACTGACAAATGAAACAGGTACTGGATCAGTCATTGGTATATCATTTGATACATCCAATATCGGAGAGGTTTCTGTAAGTAAGGATGCTTTTGAAGGAATGCGAAATCTCCGTTTCCTAAGAATCTATAGGTTGTTAGGTGGTGAAGTTACTTTGCAAATACCAGAAGATATGGATTATATACCTCGTCTTAGGTTACTATATTGGGATCGCTATCCAAGAAAAAGTCTTCCTCGGAGATTCAAGCCGGAACGTCTCGTGGAACTCCATATGCCACGCAGCAATCTCGAGCTGCTCTGGGGAGGAATCGAGCCCCTTCCTAATCTCAAGATCATAAATCTGAACCGATCCTATAGGTTGAAAGAAATCCCAAATCTTTCGAAAGCCACTAATCTCGAGAGATTGACACTTGAGAGCTGCTTAAGTTTGGTGGAGCTTCCCTCTTCTATTTCTAATCTACACAAACTGGAGATTCTAGATGTTAAATTCTGCTCTATGCTACAAGTTATTCCCACCAACATCAACTTAGCATCTCTTGAGAGACTCGACGTGAGTGGTTGCTCACGATTGAGAACTTTTCCAGATATCTCCAGTAACATCAAGACACTCATTTTCGGAAATATAAAGATAGAAGATGTCCCTCCATCAGTTGGATGTTGGTCTCGTCTTGATCAACTTCACATTAGCAGCCGAAGCCTCAAGAGATTGATGCATGTACCACCATGTATAACTTTGCTATCTCTGAGAGGTAGTGGTATAGAGAGGATTACAGATTGCGTCATAGGTCTCACTCGTCTACATTGGCTGAATGTCGATAGCTGCAGAAAACTCAAGTCAATTCTGGGTCTCCCCTCCTCCCTCAAGGTCCTAGATGCAAATGATTGTGTATCACTCAAGAGAGTACGCTTCTCTTTCCATAACCCAATGCACACACTCGATTTCAACAACTGTTTGAAACTGGATGAAGAAGCAAAAAGAGGAATCATACAACGATCAGTGTCCAGGTACATATGCTTACCATGTAAAAAGATCCCTGAAGAGTTCACTCACAAAGCAACAGGCAAATCCATAACCATCCCTCTGGCACCTGGTACTCTCTCTGCTTCCTCAAGGTTTAAGGCTTCCATTCTCATTTTGCCAGTTGAGAGCTACGAAACTGAAGGTATAAGTTGTAGTATAAGAACCAAAGGAGGTGTTGAAGTTCATTGCTGCGAGCTTCCATATCACTTTTTGCGTGTTCGGTCAGAACACCTGTTTATATTTCATGGTGACTTGTTTCCCCAAGGAAACAAATACCATGAAGTGGATGTGACTATGAGCGAGATTACATTTGAGTTCAGCCACACTAAAATCGGTGACAAGATTATTGAGTGTGGTGTACAGATCATGACAGAGGGAGCTGAGGGTGACAGTAGCAGGGAATTGGAAGTTTTGAAACTGAGAGTAGCAGCAGCCCAGTTGGGAGATTTGTTGGGAAATTTGAATTTGGAGGCAACAACAATCACCACACAGATGGAAATGGAGATGGAAACTATGAAGCAGAAGGTTCCAAGTTCTCTCAAGATGAAAACATCAAAACCAGCAAACGTTGGTTTTATGAGTTGGCTTCGGAAGCTTGGTCAGTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSSSSSHIRRHHVFSRFHGPDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEILKCKEALGQIVMTSGVFGKAFEKTCQGKNEEVKIRWRNALAHVATIAGEHSLNWDNEAKMIQKIATDVSDKLNLTPSRDFEGMVGMEAHLKRLNSLLCLESDEVKMIGIWGPAGIGKTTIARALFDDRLSSSFQHKCFMGNLKGSIKGVADHDSKLRLQKQLLSKIFKEENMKIHHLGAIRERLHDQRVLIILDDVDDLKQLEVLAKEISWFGSGSRIIGTTEDKKILKAHGIHNIYRVDFPSKKDALEILCLSAFKQSSIPDGFEELANKVAKLCSNLPLGLCVVGASLRGEGNQEWERLLSRIESSLDRDIDDILRIGYDRLLTNDKSLFLHIACFFNYAKVDNVTALLADSNLDVGNGFNTLADRSLVRISTYDDGISVLSDSNLDIVLEQSKEPGKREFIIEPEEIRDVLTNETGTGSVIGISFDTSNIGEVSVSKDAFEGMRNLRFLRIYRLLGGEVTLQIPEDMDYIPRLRLLYWDRYPRKSLPRRFKPERLVELHMPRSNLELLWGGIEPLPNLKIINLNRSYRLKEIPNLSKATNLERLTLESCLSLVELPSSISNLHKLEILDVKFCSMLQVIPTNINLASLERLDVSGCSRLRTFPDISSNIKTLIFGNIKIEDVPPSVGCWSRLDQLHISSRSLKRLMHVPPCITLLSLRGSGIERITDCVIGLTRLHWLNVDSCRKLKSILGLPSSLKVLDANDCVSLKRVRFSFHNPMHTLDFNNCLKLDEEAKRGIIQRSVSRYICLPCKKIPEEFTHKATGKSITIPLAPGTLSASSRFKASILILPVESYETEGISCSIRTKGGVEVHCCELPYHFLRVRSEHLFIFHGDLFPQGNKYHEVDVTMSEITFEFSHTKIGDKIIECGVQIMTEGAEGDSSRELEVLKLRVAAAQLGDLLGNLNLEATTITTQMEMEMETMKQKVPSSLKMKTSKPANVGFMSWLRKLGQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSSSSHIRRHHVFSRFHGPDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEILKCKEALGQIVMTSGVFGKAFEKTCQGKNEEVKIRWRNALAHVATIAGE

ProfileScan: PS50104
IPR000157
14-94 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RRHHVFSRFHGPDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEIL

Gene3D: G3DSA:3.40.50.10140
15-104 G3DSA:3.40.50.10140

RHHVFSRFHGPDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEILKCKEALGQIV

HMMSmart: SM00255
IPR000157
15-139 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RHHVFSRFHGPDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEILKCKEALGQIVMTSGVFGKAFEKTCQGKNEEVKIRWRNALAHVATI

HMMPfam: PF01582
IPR000157
18-133 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFSRFHGPDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEILKCKEALGQIVMTSGVFGKAFEKTCQGKNEEVKIRWRNAL

HMMPanther: PTHR11017:SF20
25-979 PTHR11017:SF20,SUBFAMILY NOT NAMED

PDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEILKCKEALGQIVMTSGVFGKAFEKTCQGKNEEVKIRWRNALAHVATIAGEHSLNWDNEAKMIQKIATDVSDKLNLTPSRDFEGMVGMEAHLKRLNSLLCLESDEVKMIGIWGPAGIGKTTIARALFDDRLSSSFQHKCFMGNLKGSIKGVADHDSKLRLQKQLLSKIFKEENMKIHHLGAIRERLHDQRVLIILDDVDDLKQLEVLAKEISWFGSGSRIIGTTEDKKILKAHGIHNIYRVDFPSKKDALEILCLSAFKQSSIPDGFEELANKVAKLCSNLPLGLCVVGASLRGEGNQEWERLLSRIESSLDRDIDDILRIGYDRLLTNDKSLFLHIACFFNYAKVDNVTALLADSNLDVGNGFNTLADRSLVRISTYDDGISVLSDSNLDIVLEQSKEPGKREFIIEPEEIRDVLTNETGTGSVIGISFDTSNIGEVSVSKDAFEGMRNLRFLRIYRLLGGEVTLQIPEDMDYIPRLRLLYWDRYPRKSLPRRFKPERLVELHMPRSNLELLWGGIEPLPNLKIINLNRSYRLKEIPNLSKATNLERLTLESCLSLVELPSSISNLHKLEILDVKFCSMLQVIPTNINLASLERLDVSGCSRLRTFPDISSNIKTLIFGNIKIEDVPPSVGCWSRLDQLHISSRSLKRLMHVPPCITLLSLRGSGIERITDCVIGLTRLHWLNVDSCRKLKSILGLPSSLKVLDANDCVSLKRVRFSFHNPMHTLDFNNCLKLDEEAKRGIIQRSVSRYICLPCKKIPEEFTHKATGKSITIPLAPGTLSASSRFKASILILPVESYETEGISCSIRTKGGVEVHCCELPYHFLRVRSEHLFIFHGDLFPQGNKYHEVDVTMSEITFEFSHTKIGDKIIECGVQIMTEGAEGDSSRE

HMMPanther: PTHR11017
25-979 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PDVRKGFLSHLHSLFASKGITTFNDQNIERGQTIGPELIQGIKEARVSIVVLSKNYASSSWCLDELVEILKCKEALGQIVMTSGVFGKAFEKTCQGKNEEVKIRWRNALAHVATIAGEHSLNWDNEAKMIQKIATDVSDKLNLTPSRDFEGMVGMEAHLKRLNSLLCLESDEVKMIGIWGPAGIGKTTIARALFDDRLSSSFQHKCFMGNLKGSIKGVADHDSKLRLQKQLLSKIFKEENMKIHHLGAIRERLHDQRVLIILDDVDDLKQLEVLAKEISWFGSGSRIIGTTEDKKILKAHGIHNIYRVDFPSKKDALEILCLSAFKQSSIPDGFEELANKVAKLCSNLPLGLCVVGASLRGEGNQEWERLLSRIESSLDRDIDDILRIGYDRLLTNDKSLFLHIACFFNYAKVDNVTALLADSNLDVGNGFNTLADRSLVRISTYDDGISVLSDSNLDIVLEQSKEPGKREFIIEPEEIRDVLTNETGTGSVIGISFDTSNIGEVSVSKDAFEGMRNLRFLRIYRLLGGEVTLQIPEDMDYIPRLRLLYWDRYPRKSLPRRFKPERLVELHMPRSNLELLWGGIEPLPNLKIINLNRSYRLKEIPNLSKATNLERLTLESCLSLVELPSSISNLHKLEILDVKFCSMLQVIPTNINLASLERLDVSGCSRLRTFPDISSNIKTLIFGNIKIEDVPPSVGCWSRLDQLHISSRSLKRLMHVPPCITLLSLRGSGIERITDCVIGLTRLHWLNVDSCRKLKSILGLPSSLKVLDANDCVSLKRVRFSFHNPMHTLDFNNCLKLDEEAKRGIIQRSVSRYICLPCKKIPEEFTHKATGKSITIPLAPGTLSASSRFKASILILPVESYETEGISCSIRTKGGVEVHCCELPYHFLRVRSEHLFIFHGDLFPQGNKYHEVDVTMSEITFEFSHTKIGDKIIECGVQIMTEGAEGDSSRE

superfamily: SSF52540
159-406 SSF52540

TDVSDKLNLTPSRDFEGMVGMEAHLKRLNSLLCLESDEVKMIGIWGPAGIGKTTIARALFDDRLSSSFQHKCFMGNLKGSIKGVADHDSKLRLQKQLLSKIFKEENMKIHHLGAIRERLHDQRVLIILDDVDDLKQLEVLAKEISWFGSGSRIIGTTEDKKILKAHGIHNIYRVDFPSKKDALEILCLSAFKQSSIPDGFEELANKVAKLCSNLPLGLCVVGASLRGEGNQEWERLLSRIESSLDRDI

Gene3D: G3DSA:3.40.50.300
171-208 G3DSA:3.40.50.300

RDFEGMVGMEAHLKRLNSLLCLESDEVKMIGIWGPAGI

HMMPfam: PF00931
IPR002182
180-439 NB-ARC,NBS
NB-ARC

EAHLKRLNSLLCLESDEVKMIGIWGPAGIGKTTIARALFDDRLSSSFQHKCFMGNLKGSIKGVADHDSKLRLQKQLLSKIFKEENMKIHHLGAIRERLHDQRVLIILDDVDDLKQLEVLAKEISWFGSGSRIIGTTEDKKILKAHGIHNIYRVDFPSKKDALEILCLSAFKQSSIPDGFEELANKVAKLCSNLPLGLCVVGASLRGEGNQEWERLLSRIESSLDRDIDDILRIGYDRLLTNDKSLFLHIACFFNYAKVDN

HMMSmart: SM00382
IPR003593
196-335 AAA,NBS
AAA+ ATPase domain

EVKMIGIWGPAGIGKTTIARALFDDRLSSSFQHKCFMGNLKGSIKGVADHDSKLRLQKQLLSKIFKEENMKIHHLGAIRERLHDQRVLIILDDVDDLKQLEVLAKEISWFGSGSRIIGTTEDKKILKAHGIHNIYRVDFP

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

MIGIWGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
209-257 G3DSA:3.40.50.300

GKTTIARALFDDRLSSSFQHKCFMGNLKGSIKGVADHDSKLRLQKQLLS

Gene3D: G3DSA:3.40.50.300
258-381 G3DSA:3.40.50.300

KIFKEENMKIHHLGAIRERLHDQRVLIILDDVDDLKQLEVLAKEISWFGSGSRIIGTTEDKKILKAHGIHNIYRVDFPSKKDALEILCLSAFKQSSIPDGFEELANKVAKLCSNLPLGLCVVGA

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

RLHDQRVLIILDDVD

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

CSNLPLGLCVVGASL

superfamily: SSF46785
404-508 SSF46785

RDIDDILRIGYDRLLTNDKSLFLHIACFFNYAKVDNVTALLADSNLDVGNGFNTLADRSLVRISTYDDGISVLSDSNLDIVLEQSKEPGKREFIIEPEEIRDVLT

superfamily: SSF52058
502-825 SSF52058,LRR

EIRDVLTNETGTGSVIGISFDTSNIGEVSVSKDAFEGMRNLRFLRIYRLLGGEVTLQIPEDMDYIPRLRLLYWDRYPRKSLPRRFKPERLVELHMPRSNLELLWGGIEPLPNLKIINLNRSYRLKEIPNLSKATNLERLTLESCLSLVELPSSISNLHKLEILDVKFCSMLQVIPTNINLASLERLDVSGCSRLRTFPDISSNIKTLIFGNIKIEDVPPSVGCWSRLDQLHISSRSLKRLMHVPPCITLLSLRGSGIERITDCVIGLTRLHWLNVDSCRKLKSILGLPSSLKVLDANDCVSLKRVRFSFHNPMHTLDFNNCLKL

Gene3D: G3DSA:3.80.10.10
526-812 G3DSA:3.80.10.10

IGEVSVSKDAFEGMRNLRFLRIYRLLGGEVTLQIPEDMDYIPRLRLLYWDRYPRKSLPRRFKPERLVELHMPRSNLELLWGGIEPLPNLKIINLNRSYRLKEIPNLSKATNLERLTLESCLSLVELPSSISNLHKLEILDVKFCSMLQVIPTNINLASLERLDVSGCSRLRTFPDISSNIKTLIFGNIKIEDVPPSVGCWSRLDQLHISSRSLKRLMHVPPCITLLSLRGSGIERITDCVIGLTRLHWLNVDSCRKLKSILGLPSSLKVLDANDCVSLKRVRFSFHN

HMMPfam: PF07725
IPR011713
591-608 LRR_3
Leucine-rich repeat 3

LVELHMPRSNLELLWGGI

FPrintScan: PR00364
IPR000767
679-695 DISEASERSIST
Disease resistance protein

INLASLERLDVSGCSRL

HMMPfam: PF00560
IPR001611
683-702 LRR_1
Leucine-rich repeat

SLERLDVSGCSRLRTFPDIS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox