PRGDB00046979 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22325728 (NM_127261)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT2G17060) mRNA, complete cds.

DNA Sequence

ATGAAAGAAAGTCCCACTTTGAGAAGATATTCCATGGAGGCCTCACGGCAACCTCAAGTGTTCATCAACTTCCGGGGAAGTGAACTACGGTATACCTTTGTCTACTATCTCAGGACGGCCTTGGTAAAAAACGGGATCAACGTTTTTACAGACAACATGGAGCCGAAAGGCCGTAACCAGAAAATTTTATTCAAGAGAATCGAAGAGTCGAAGATCGCACTGGCGATTTTCTCCTCAAGGTATACGGAGTCAAGTTGGTGTCTGGAAGAGCTGGTAAAGATGAAAGAATGCATGGATGCGGAGAAACTCGTGATCATTCCCATCTTCTACATCGTGACTCCATACACCATTAAAAAGCAGATGGGAGACTTTGGTGACAAGTTTAGAGTGCTGGTGGATTATGTTGATGATGTGACGGAGAAAAAATGGACTGATGCTTTGAAGTCTGTTCCCTTAATTTTAGGCATCACTTACGACGGGCAGAGCGAAGAACAACTTTTAATCAATCAAATCGTTGGGGAGGTTCAGAGAGTAATAAAGATAATTTCACAAGGAGAAGGAGATGAAAAAAATAAAATGGTGTGCACAAATACCTCTACAGGTTCAAGCTTTATCCCACAAAATAGAAACATGGTAGATCCTGAAAATCAAATTGAGCTCGTTGGACTCAGCCAACGCCTCAAGGAACTAAAAGAAAAGTTGGACCTTAGCCGCAAGGAAACTCGCATTGTTGGGGTTTTAGGGATGCCCGGAATCGGCAAGACCACACTGGTGAAGAGATTGTATGATGAGTGGAAACACAATTTCCAGCGTCACTTGCATATGGTGAATATCCGTCAGAAGTCGAAGGAATACGGGACGCATTCCCTAGAGAGAATGATTCTGAAAGAGTTGCTTAGCGACACTTACAATGATATAACTGAAGAGATGACGTACGCTTCTGTAAAGGATGAGCTGCTGAAGAAGAAAGTTCTTCTTGTTCTCGATGACGTGAGTAGCAAGAAACAAATACAAGGTCTTCTCGGGAATCTTAACTGGATTAGGAAAGGAAGCAGGATTGTTATTACTACGCGTGACAAGATATCCATAAGCCAGTTCGAGTATACTTATGTTGTCCCAAGATTGAATATCACAGATGGCTTAAAGCAATTCAGCTTTTATGCCTTTGAAGATCACAACTGTCCATACCCGGGGAATCTCATGGATCTTTCCACAAAGTTCGTAGATTATGCCAGAGGCAATCCCTTAGCTCTCAAGATATTGGGTCGGGAGCTTCTTTCGATAGACAAGGATCAGTGGCCAAAGAGACTCGATACTCTGGCACAACTTCCCATCCCGTATATACAGGATCTATTGAGAGCAAGTTATGATGATCTGAGCAATCAACAGAAAGAAGTTTTTCTTGTCGTAGCCTGGTTCTTTGGATCAGGGGATGAATATTACATTAGGAGTTTAGTGGATACAGAAGATCCTGATTCTGCCGATGATGCTGCTAGCGAAGTAAGAGATTTCGCAGGCAACTTACTAATTAGCATCTCAAGTGGTCGATTGGAGATGCATGATTTAATGGCTACGTTCGCCAAAAAACTTTGTTCATCCTTATCTAATGAAAATAACTATGGATACCAAATGATTTGGAATCATGAAAGCTTTAATGCTGCGGCTAAAAATAAAAGGATGAGATATGTCAATCAACCAAGGAAAAAAGTCACAGAATCGGAAATGGACAATGTCATGGGTATATTGCTGGACGTGTCTGAAATGGATAATAACATGACCTTAGATTCTAAATTCTTCAGCGAGATGTGCAATCTACGGTACCTCAAAGTCTACAATTCACAATGCTCTCGAGATTGTGATGTTGGTTGCAAACTGACCTTCCCAGATGGACTTAAATGCTCAATGGAAAATGTCCGATATCTCTATTGGCTACAATTCCCATTGAAGAAGCTTTCAAAAGCATTTAACCCTAAGAATCTTATCGAGCTCAACCTCCCTTACAGCAAAATTACACGACTTTGGAAGGAAAGTAAGGAAATATCCAAACTAAAATGGGTCGATCTCAGCCACTCGAGTGAGCTATGCGATATATCAGGGTTAATAGGAGCTCATAATATTAGAAGATTGAATCTTGAAGGCTGCATAGAATTGAAAACATTACCACAAGAGATGCAAGAAATGGAAAGTCTGATTTATCTAAACCTGGGAGGATGCACGCGTCTTGTGTCTCTTCCAGAGTTTAAGTTGAAATCCCTAAAGACTCTCATCTTAAGTCACTGCAAGAACTTTGAACAATTTCCGGTTATTTCAGAATGTTTAGAAGCTCTTTACTTGCAAGGCACGGCAATAAAGTGTATTCCTACCTCCATTGAGAACCTTCAGAAACTAATCCTATTGGATCTAAAAGACTGCGAAGTATTGGTAAGTCTTCCTGATTGTCTTGGAAATCTAAGATCTCTTCAAGAGCTAATACTCTCTGGCTGCTCAAAGTTAAAGTTTTTTCCAGAGTTGAAGGAGACCATGAAATCAATAAAGATTTTGCTGCTTGATGGAACAGCCATTAAGCAGATGCCAATATTATTGCAGTGTATTCAGTCACAAGGCCACTCTGTTGCAAATAAGACGCTTCCAAACAGTTTAAGTGATTACTACCTACCTTCCTCATTGTTGTCTTTATGCTTAAGTGGAAATGATATCGAGAGCTTGCATGCTAACATCAGCCAGCTTTATCATCTGAAATGGCTTGACTTGAAGAATTGCAAGAAGCTTAAATCTGTGTCGGTGCTTCCACCAAACCTCAAGTGCTTAGATGCACATGGTTGTGACTCACTGGAAGAAGTTGGAAGCCCTCTAGCGGTTCTCATGGTGACAGGAAAAATCCATTGCACATACATTTTCACAAACTGCAACAAATTGGATCAAGTTGCAGAAAGTAACATCATATCTTTCACTTGGAGGAAAAGCCAGATGATGTCAGATGCTCTGAATCGCTACAATGGGGGATTTGTTTTGGAATCTTTGGTCAGCACTTGCTTTCCTGGATGTGAAGTACCTGCATCATTCGATCACCAAGCCTATGGAGCATTGTTACAGACGAAATTACCTCGGCACTGGTGTGATAGTAGGCTTACTGGGATAGCTTTATGCGCTGTTATATTGTTTCCGGACTACCAACATCAAAGCAATCGTTTCTTGGTGAAATGCACTTGTGAGTTCGGAACTGAAGATGGGCCATGTATCAGCTTTAGTTCCATTGTTGGAGACATTAACAAACGTCACGTGGAAAAGCATGGGAATGGATGTATTCCTTCTAAGGCTTCACTCAGATTTCAAGTCACAGATGGTGCGAGTGAGGTAGGAAATTGCCATGTCCTGAAATGTGGCTTTACTTTAGTGTATACACCAAACGATAGTGATGATATCTCTCCGGCGAGAGTAGTTGATATCACTACACGGGATAAGGAGGATGGCCTAGAAAATGCAACTTCTAACAAACTTTCAAGAAACGATTATGAATTCTCGCATCAGTCAAACTGTGGAGTGACTTCGAGAAGGGATGAATGTTTCCTTTCTGAAGAGCTTCCATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MKESPTLRRYSMEASRQPQVFINFRGSELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLILGITYDGQSEEQLLINQIVGEVQRVIKIISQGEGDEKNKMVCTNTSTGSSFIPQNRNMVDPENQIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFFGSGDEYYIRSLVDTEDPDSADDAASEVRDFAGNLLISISSGRLEMHDLMATFAKKLCSSLSNENNYGYQMIWNHESFNAAAKNKRMRYVNQPRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKIHCTYIFTNCNKLDQVAESNIISFTWRKSQMMSDALNRYNGGFVLESLVSTCFPGCEVPASFDHQAYGALLQTKLPRHWCDSRLTGIALCAVILFPDYQHQSNRFLVKCTCEFGTEDGPCISFSSIVGDINKRHVEKHGNGCIPSKASLRFQVTDGASEVGNCHVLKCGFTLVYTPNDSDDISPARVVDITTRDKEDGLENATSNKLSRNDYEFSHQSNCGVTSRRDECFLSEELP

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
6-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TLRRYSMEASRQPQVFINFRGSELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLILGI

ProfileScan: PS50104
IPR000157
16-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RQPQVFINFRGSELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLI

HMMSmart: SM00255
IPR000157
17-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QPQVFINFRGSELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLI

Gene3D: G3DSA:3.40.50.10140
19-129 G3DSA:3.40.50.10140

QVFINFRGSELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFR

HMMPfam: PF01582
IPR000157
20-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGSELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALK

HMMPanther: PTHR23155:SF245
27-985 PTHR23155:SF245,SUBFAMILY NOT NAMED

SELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLILGITYDGQSEEQLLINQIVGEVQRVIKIISQGEGDEKNKMVCTNTSTGSSFIPQNRNMVDPENQIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFFGSGDEYYIRSLVDTEDPDSADDAASEVRDFAGNLLISISSGRLEMHDLMATFAKKLCSSLSNENNYGYQMIWNHESFNAAAKNKRMRYVNQPRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKIHCTYIFTNCNKLDQVAESNIISFTW

HMMPanther: PTHR23155
27-985 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SELRYTFVYYLRTALVKNGINVFTDNMEPKGRNQKILFKRIEESKIALAIFSSRYTESSWCLEELVKMKECMDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLILGITYDGQSEEQLLINQIVGEVQRVIKIISQGEGDEKNKMVCTNTSTGSSFIPQNRNMVDPENQIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFFGSGDEYYIRSLVDTEDPDSADDAASEVRDFAGNLLISISSGRLEMHDLMATFAKKLCSSLSNENNYGYQMIWNHESFNAAAKNKRMRYVNQPRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKIHCTYIFTNCNKLDQVAESNIISFTW

Gene3D: G3DSA:3.40.50.300
217-356 G3DSA:3.40.50.300

QIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVIT

superfamily: SSF52540
219-448 SSF52540

ELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYI

HMMPfam: PF00931
IPR002182
225-474 NB-ARC,NBS
NB-ARC

QRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFF

FPrintScan: PR00364
IPR000767
243-258 DISEASERSIST
Disease resistance protein

IVGVLGMPGIGKTTLV

FPrintScan: PR00364
IPR000767
318-332 DISEASERSIST
Disease resistance protein

ELLKKKVLLVLDDVS

FPrintScan: PR00364
IPR000767
411-425 DISEASERSIST
Disease resistance protein

ARGNPLALKILGREL

superfamily: SSF52058
566-960 SSF52058,LRR

PRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKI

Gene3D: G3DSA:3.80.10.10
594-861 G3DSA:3.80.10.10

LDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILL

HMMPfam: PF07725
IPR011713
659-676 LRR_3
Leucine-rich repeat 3

NLIELNLPYSKITRLWKE

HMMPfam: PF00560
IPR001611
729-750 LRR_1
Leucine-rich repeat

SLIYLNLGGCTRLVSLPEFKLK

FPrintScan: PR00364
IPR000767
747-763 DISEASERSIST
Disease resistance protein

FKLKSLKTLILSHCKNF

HMMPfam: PF13855
773-828 LRR_8,Leucine rich repeat

LEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGC

Gene3D: G3DSA:3.80.10.10
876-945 G3DSA:3.80.10.10

LPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox