PRGDB00046980 (disease resistance protein (TIR-NBS class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145337336 (NM_105624)
Gene Class TNL
Domain Type LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS class), putative (AT1G69550) mRNA, complete cds.

DNA Sequence

ATGCTAATGGATTCTTCTTTTTTCCTTACCATTGTTGCTGCTGCTTTTGCAATAGGCTTCTTCATCTTTCTTAGAAAGTTGAGAATCCATCAAGAAAACGAAGATGTGGGTTCTTCTTCTACATCTCCTCCATCGTCTTTGGCGTCTTCAACATCTCCTCCATCTACGTTGTCTTCTTCAACATCTCATCCGTCTTCTTCAACTTCTCCTCCATCATCTTTGTCTTGCACCGGGACTCACCATGTATTTCCAAGCTTCCGTGGGGATGACGTTCGCAGAAACTTTCTCAGTCACATTCAAAAGGAGTTTCGGAGAAAAGGAATCACTCCGTTCATCGATAATGAGATTAGGAGAGGAGAATCCATCGGTCCTGAACTCATTAAGGCCATTAGAGAATCTAAGATCGCAATTGTTCTGCTCTCGAGGAACTATGCTTCTTCAAAGTGGTGTCTTGAAGAATTGGTGGAGATTATGAAATGCAAGAAAGAGTTTGGTCTAACAGTGTTTGCCATTTTCTATGAAGTTGATCCATCCCATGTTAAGAAGCTTACCGGAGAATTTGGAGCTGTCTTTCAGAAAACTTGTAAGGGTAGAACAAAGGAGAATATTATGAGATGGAGACAAGCTTTTGAGGAGGTTGCTACAATTGCTGGTTACGATTCAAGAAACTGGGAAAATGAAGCTGCCATGATTGAAGAAATTGCCATTGAAATTTCCAAAAGATTGATTAATTCCTCACCGTTCAGTGGGTTTGAAGGTTTGATTGGGATGAAAGCTCATATAGAAAAGATGAAACAGTTGCTTTGCCTCGATTCAACAGATGAAAGGAGGACGGTTGGTATTTCAGGTCCTTCTGGAATTGGTAAGAGCACTATTGCTAGAGTTCTACATAATCAAATCTCTGATGGTTTTCAAATGAGTGTTTTCATGAAATTCAAACCAAGTTATACAAGACCAATTTGTTCTGATGATCACGATGTGAAGTTGCAATTAGAGCAGCAATTTCTAGCTCAATTGATTAACCAAGAGGATATCAAGATTCATCAGTTAGGAACTGCGCAAAACTTTGTGATGGGAAAGAAAGTGCTTATTGTTCTTGATGGGGTGGATCAATTAGTACAATTACTTGCCATGCCAAAGGCGGTATGCCTCGGTCCTGGATCTCGTATTATCATCACAACACAAGATCAACAACTTTTGAAGGCGTTTCAGATCAAACATATTTACAATGTGGATTTTCCACCAGATCATGAGGCTCTTCAAATCTTCTGCATCCATGCTTTTGGTCATGATTCCCCTGATGATGGTTTCGAGAAGCTTGCTACGAAAGTTACAAGACTTGCTGGTAATCTCCCTTTGGGACTTAGGGTTATGGGTTCTCATTTCCGGGGAATGTCCAAGGAAGATTGGAAAGGGGAACTACCAAGGTTACGGATTCGCCTTGACGGAGAAATAGGGAGCATTTTAAAATTTAGTTACGATGTCTTGGACGACGAAGACAAAGATTTGTTTCTCCATATAGCATGTTTTTTTAACGACGAAGGCATTGATCATACCTTTGAAGATACTCTTCGTCACAAATTCTCAAACGTGCAGCGAGGGCTTCAGGTCTTAGTTCAAAGATCTCTCATATCCGAGGATTTAACTCAACCGATGCATAATCTACTAGTTCAATTGGGTAGAGAAATTGTTCGTAACCAATCCGTTTATGAACCTGGGAAACGTCAATTTCTAGTTGATGGAAAGGAGATTTGTGAAGTACTTACTAGTCATACAGGAAGTGAAAGTGTTATAGGCATAAATTTCGAAGTTTATTGGAGCATGGACGAACTAAATATAAGTGATAGAGTTTTTGAAGGAATGTCTAATCTTCAATTTTTTAGATTCGATGAAAATTCTTATGGAAGATTGCACTTGCCACAAGGTCTAAACTATCTACCTCCAAAACTTAGAATTCTACATTGGGATTACTATCCGATGACAAGTTTGCCTTCTAAGTTTAATCTGAAGTTTCTTGTCAAGATAATATTGAAACACAGTGAGCTCGAGAAACTGTGGGAAGGAATTCAAGTAAGCATTTACCATTCTTTTATGAAATTTATTTTATTTTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS class), putative disease resistance protein (TIR-NBS class), putative [Arabidopsis thaliana].

MLMDSSFFLTIVAAAFAIGFFIFLRKLRIHQENEDVGSSSTSPPSSLASSTSPPSTLSSSTSHPSSSTSPPSSLSCTGTHHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGIDHTFEDTLRHKFSNVQRGLQVLVQRSLISEDLTQPMHNLLVQLGREIVRNQSVYEPGKRQFLVDGKEICEVLTSHTGSESVIGINFEVYWSMDELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLWEGIQVSIYHSFMKFILF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
68-219 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TSPPSSLSCTGTHHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGY

ProfileScan: PS50104
IPR000157
78-216 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GTHHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATI

HMMSmart: SM00255
IPR000157
79-216 TIR
Toll/interleukin-1 receptor homology (TIR) domain

THHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATI

Gene3D: G3DSA:3.40.50.10140
80-214 G3DSA:3.40.50.10140

HHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVA

HMMPfam: PF01582
IPR000157
82-210 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAF

HMMPanther: PTHR11017:SF20
104-690 PTHR11017:SF20,SUBFAMILY NOT NAMED

RRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGIDHTFEDTLRHKFSNVQRGLQVLVQRSLISEDLTQPMHNLLVQLGREIVRNQSVYEPGKRQFLVDGKEICEVLTSHTGSESVIGINFEVYWSMDELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLWEGIQ

HMMPanther: PTHR11017
104-690 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RRKGITPFIDNEIRRGESIGPELIKAIRESKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGIDHTFEDTLRHKFSNVQRGLQVLVQRSLISEDLTQPMHNLLVQLGREIVRNQSVYEPGKRQFLVDGKEICEVLTSHTGSESVIGINFEVYWSMDELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLWEGIQ

superfamily: SSF52540
133-505 SSF52540

SKIAIVLLSRNYASSKWCLEELVEIMKCKKEFGLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCKGRTKENIMRWRQAFEEVATIAGYDSRNWENEAAMIEEIAIEISKRLINSSPFSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFL

Gene3D: G3DSA:3.40.50.300
248-289 G3DSA:3.40.50.300

FSGFEGLIGMKAHIEKMKQLLCLDSTDERRTVGISGPSGIGK

HMMPfam: PF00931
IPR002182
258-516 NB-ARC,NBS
NB-ARC

KAHIEKMKQLLCLDSTDERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFPPDHEALQIFCIHAFGHDSPDDGFEKLATKVTRLAGNLPLGLRVMGSHFRGMSKEDWKGELPRLRIRLDGEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGI

HMMSmart: SM00382
IPR003593
275-414 AAA,NBS
AAA+ ATPase domain

ERRTVGISGPSGIGKSTIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGKKVLIVLDGVDQLVQLLAMPKAVCLGPGSRIIITTQDQQLLKAFQIKHIYNVDFP

FPrintScan: PR00364
IPR000767
278-293 DISEASERSIST
Disease resistance protein

TVGISGPSGIGKSTIA

Gene3D: G3DSA:3.40.50.300
290-360 G3DSA:3.40.50.300

STIARVLHNQISDGFQMSVFMKFKPSYTRPICSDDHDVKLQLEQQFLAQLINQEDIKIHQLGTAQNFVMGK

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

FVMGKKVLIVLDGVD

FPrintScan: PR00364
IPR000767
448-462 DISEASERSIST
Disease resistance protein

AGNLPLGLRVMGSHF

superfamily: SSF46785
483-589 SSF46785

GEIGSILKFSYDVLDDEDKDLFLHIACFFNDEGIDHTFEDTLRHKFSNVQRGLQVLVQRSLISEDLTQPMHNLLVQLGREIVRNQSVYEPGKRQFLVDGKEICEVLT

Gene3D: G3DSA:3.40.50.300
568-613 G3DSA:3.40.50.300

SVYEPGKRQFLVDGKEICEVLTSHTGSESVIGINFEVYWSMDELNI

superfamily: SSF52047
609-690 SSF52047,LRR

DELNISDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLWEGIQ

Gene3D: G3DSA:3.80.10.10
614-687 G3DSA:3.80.10.10

SDRVFEGMSNLQFFRFDENSYGRLHLPQGLNYLPPKLRILHWDYYPMTSLPSKFNLKFLVKIILKHSELEKLWE

HMMPfam: PF07725
IPR011713
671-690 LRR_3
Leucine-rich repeat 3

FLVKIILKHSELEKLWEGIQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox