PRGDB00046981 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30688600 (NM_122175)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G22690) mRNA, complete cds.

DNA Sequence

ATGGCTCTTTCTTATCGCAATTGGTTGTACGACGTGTTCCCGAGCTTCAGCGGAGAAGACGTACGTGTAACTTTCCTCAGCCACTTTCTGAAGGAGCTTGATCGGAAATTGATTAGTGTATTCAAAGACAACGATATCCAGAGAAGTCAATCGCTCGATCCCGAGCTTAAACTGGCGATTAGGGATTCGAGGATTGCAATCGTCGTCTTCTCCAAAAACTACGCTGCTTCTAGCTGGTGCCTTGACGAGTTGCTGGAGATTGTGAAATGTAAAGAAGAGTTTGGTCAAATTGTAATTCCCGTTTTCTACGGTTTGGATCCTTGTCATGTTAGGAAACAGAGTGGCGAATTCGGAATTGTGTTTGAAAACACTTGCCAGACCAAAACAGATGATGAGATACAAAAATGGCGGAGAGCATTGACTGATGTAGCTAACATCCTCGGGTTTCATTCTTCCAACTGGGATAATGAAGCAACCATGGTTGAAGATATAGCCAATGATGTTTTGGCTAAACTGAATTTAACTACAACATCTAATGACTTTGAGGGTTTTGTTGGCATCGAAGGTCATATCGCAAAGATTAGTTTAATGTTGTGCTTGGAATGTAAACAAGTGAGGATGTTTGGGATTTGGGGACCTTCTGGTATTGGAAAGACTACCATTGCTAGAGCTCTGTTTAGTCGAATCTCTCGTCATTTCCAAGGTAGCGTTTTCTTAGACAGAGCTTTCGTGTCTAAGAGTATGGAAATTTATAGTGGAGGCAACGTGGACAACTACAACGCCAAGCTGCATTTGCAAGGAAAGTTTTTGTCTGAAATTTTAAGAGCAAAAGACATAAAGATATCTAATTTAGGTGTTGTGGGAGAGAGGCTAAAGCATATGAAAGTTTTAATCTTTATTGATGATTTGGATGATCAAGTGGTGTTAGATGCTTTGGCGAGTAAACCTCATTGGTTTGGTTGTGGGAGCAGAATCATTGTTATTACAAAAGATAAGCAATTTTTTAGGGCTCATGGGATTGGTCTTTTTTACGAAGTGGGTCTCCCATCTGATAAACTAGCTCTAGAGATGTTCTCTCAGTCTGCTTTCAGGCAAAACTCTCCACCTCCTGGTTTCACAGAGCTTGCTTCTGAAGTTTCAAAACGTTCTGGTAATCTTCCTTTGGCTCTTAATGTTTTGGGTTCGCATCTTCGAGGGAGGGACAAAGAAGATTGGATTGATATGTTGCCAAGGCTTCGAAAAGGTTTGGATGGGAAGATTGAGAAAATATTAAGAGTTGGCTACGATGAGTTAAGTAATAAAGATGATAAAGCTATATTTCGTCTCATCGCATGTCTCTTCAATGGTGCGGAAATCAGTTACATCAAGCTGCTACTTGCAGATAGTAACTTGGGTGTTACCATTGGGCTTAAAAACCTAGTTGATAAGTCCCTCATACGTATTGGGTGTGACACTGTGGAGATGCACAGCATGTTACAAGAAATGGGTAGAGAAATTGTTCGGGAACAGTCCATTTACGAGCCTGGAGAACGGGAATTTCTGGTGGATTCGACGGATATTTTGGATGTACTTAATGATAACACTGGTACGAAAAAGGTTTTAGGTATATCATTTGATATGTCTGAGATTGAGGAGTTGCACATACATAAGAGAGCCTTCAAAAGGATGCCTAATCTCAGGTTCTTAAGATTTTACAAGAAATTAGGGAAGCAGAGTAAAGAAGCCAGATTGCACCTACAAGAAGGCTTTGACAAGTTTTTCCCCCCTAAACTCAAATTACTGAGTTGGGATGACTACCCGATGAGGCGTATGCCTTCTAACTTTCATGCTGGATATCTCGTTGTACTGAGAATGCAACACAGCAAGCTCGAAAAGTTATGGCAAGGAGTTCAGCCGCTTACATGCCTCAGGGAGATGCAGTTGTGGGGATCAAAAAAACTGAAAGAAATCCCAGATCTCTCGTTGGCCACCAATCTTGAAACACTTTATCTCAACGATTGCTCGAGTTTAGTGGAGCTTCCTTCCTCTATCAAGAATCTGAATAAACTGTGGGACTTGGGTATGAAAGGATGTGAAAAGCTGGAGCTTCTTCCAACCGACATCAACCTCAAATCTCTCTATCGCCTTGATCTTGGTAGATGCTCACGGTTGAAGAGTTTTCCTGATATCTCAAGTAACATTTCAGAGCTCTATCTGAATCGAACAGCGATTGAAGAAGTTCCTTGGTGGATCCAGAAATTCTCCAGGCTTAAACGTTTACGTATGAGGGAATGCAAAAAGCTCAAATGTATATCTCCAAACATCTCCAAACTGAAACATCTTGAGATGCTCGACTTTTCAAACTGCATAGCAACTACAGAAGAAGAAGCTCTTGTTCAACAACAATCAGTTTTGAAGTATCTCATATTTCCAGGAGGACAAGTGCCTTTGTATTTCACTTACCAAGCTACTGGAAGCTCTTTGGCCATCCCTTTGTCATTACATCAGAGCTCTCTCTCTCAACAATTATTGGGATTTAGGGCTTGCGTCGTGCTTGATGCTGAATCTATGTCCTCCGAGTTATACGTAATTGATATCAAGGTATGTTGTCGCTTGAGTGGTAAACGCAGCAACCTCTTTGATTCCGCTGACTGTCGGGATGCCTTCTTTACACCTCAGATGGATAGTCATTTGGTTATATTTGATTGTTGTTTCCCTCTAAACCAAGATAACGTTCGTCTAGCTGAACTGAACAATGATAAGGTGGTCACAGAGTTTCATTTCACTAGTATTTCTCGCTGCAAAATAACAGGAGTCGGTGTACGCTTCCTCAGGGACTGTTCATTACCAGAGAACCATCATAATGATCCAAATATTCTTGCACCTAATTGTGGATGCCCTGAGACTGAACACTCTGATGAGTATGGAGAATTCGGTGTAGAGACGAAAAGAAGTAGGAAGCGAAAGCGGATAACCTTAAGGACCGCTCAAGAAACTATTGACTTGCCCTACCTTCAGATCCGGGAAGAACAGAGGATGTCACTTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MALSYRNWLYDVFPSFSGEDVRVTFLSHFLKELDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANILGFHSSNWDNEATMVEDIANDVLAKLNLTTTSNDFEGFVGIEGHIAKISLMLCLECKQVRMFGIWGPSGIGKTTIARALFSRISRHFQGSVFLDRAFVSKSMEIYSGGNVDNYNAKLHLQGKFLSEILRAKDIKISNLGVVGERLKHMKVLIFIDDLDDQVVLDALASKPHWFGCGSRIIVITKDKQFFRAHGIGLFYEVGLPSDKLALEMFSQSAFRQNSPPPGFTELASEVSKRSGNLPLALNVLGSHLRGRDKEDWIDMLPRLRKGLDGKIEKILRVGYDELSNKDDKAIFRLIACLFNGAEISYIKLLLADSNLGVTIGLKNLVDKSLIRIGCDTVEMHSMLQEMGREIVREQSIYEPGEREFLVDSTDILDVLNDNTGTKKVLGISFDMSEIEELHIHKRAFKRMPNLRFLRFYKKLGKQSKEARLHLQEGFDKFFPPKLKLLSWDDYPMRRMPSNFHAGYLVVLRMQHSKLEKLWQGVQPLTCLREMQLWGSKKLKEIPDLSLATNLETLYLNDCSSLVELPSSIKNLNKLWDLGMKGCEKLELLPTDINLKSLYRLDLGRCSRLKSFPDISSNISELYLNRTAIEEVPWWIQKFSRLKRLRMRECKKLKCISPNISKLKHLEMLDFSNCIATTEEEALVQQQSVLKYLIFPGGQVPLYFTYQATGSSLAIPLSLHQSSLSQQLLGFRACVVLDAESMSSELYVIDIKVCCRLSGKRSNLFDSADCRDAFFTPQMDSHLVIFDCCFPLNQDNVRLAELNNDKVVTEFHFTSISRCKITGVGVRFLRDCSLPENHHNDPNILAPNCGCPETEHSDEYGEFGVETKRSRKRKRITLRTAQETIDLPYLQIREEQRMSL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ALSYRNWLYDVFPSFSGEDVRVTFLSHFLKELDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANILGF

Gene3D: G3DSA:3.40.50.10140
6-147 G3DSA:3.40.50.10140

RNWLYDVFPSFSGEDVRVTFLSHFLKELDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANIL

ProfileScan: PS50104
IPR000157
8-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WLYDVFPSFSGEDVRVTFLSHFLKELDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANI

HMMSmart: SM00255
IPR000157
9-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LYDVFPSFSGEDVRVTFLSHFLKELDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANI

HMMPfam: PF01582
IPR000157
12-141 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGEDVRVTFLSHFLKELDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALT

HMMPanther: PTHR11017:SF20
33-1006 PTHR11017:SF20,SUBFAMILY NOT NAMED

LDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANILGFHSSNWDNEATMVEDIANDVLAKLNLTTTSNDFEGFVGIEGHIAKISLMLCLECKQVRMFGIWGPSGIGKTTIARALFSRISRHFQGSVFLDRAFVSKSMEIYSGGNVDNYNAKLHLQGKFLSEILRAKDIKISNLGVVGERLKHMKVLIFIDDLDDQVVLDALASKPHWFGCGSRIIVITKDKQFFRAHGIGLFYEVGLPSDKLALEMFSQSAFRQNSPPPGFTELASEVSKRSGNLPLALNVLGSHLRGRDKEDWIDMLPRLRKGLDGKIEKILRVGYDELSNKDDKAIFRLIACLFNGAEISYIKLLLADSNLGVTIGLKNLVDKSLIRIGCDTVEMHSMLQEMGREIVREQSIYEPGEREFLVDSTDILDVLNDNTGTKKVLGISFDMSEIEELHIHKRAFKRMPNLRFLRFYKKLGKQSKEARLHLQEGFDKFFPPKLKLLSWDDYPMRRMPSNFHAGYLVVLRMQHSKLEKLWQGVQPLTCLREMQLWGSKKLKEIPDLSLATNLETLYLNDCSSLVELPSSIKNLNKLWDLGMKGCEKLELLPTDINLKSLYRLDLGRCSRLKSFPDISSNISELYLNRTAIEEVPWWIQKFSRLKRLRMRECKKLKCISPNISKLKHLEMLDFSNCIATTEEEALVQQQSVLKYLIFPGGQVPLYFTYQATGSSLAIPLSLHQSSLSQQLLGFRACVVLDAESMSSELYVIDIKVCCRLSGKRSNLFDSADCRDAFFTPQMDSHLVIFDCCFPLNQDNVRLAELNNDKVVTEFHFTSISRCKITGVGVRFLRDCSLPENHHNDPNILAPNCGCPETEHSDEYGEFGVETKRSRKRKRITLRTAQETIDLPYLQIREEQRM

HMMPanther: PTHR11017
33-1006 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDRKLISVFKDNDIQRSQSLDPELKLAIRDSRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANILGFHSSNWDNEATMVEDIANDVLAKLNLTTTSNDFEGFVGIEGHIAKISLMLCLECKQVRMFGIWGPSGIGKTTIARALFSRISRHFQGSVFLDRAFVSKSMEIYSGGNVDNYNAKLHLQGKFLSEILRAKDIKISNLGVVGERLKHMKVLIFIDDLDDQVVLDALASKPHWFGCGSRIIVITKDKQFFRAHGIGLFYEVGLPSDKLALEMFSQSAFRQNSPPPGFTELASEVSKRSGNLPLALNVLGSHLRGRDKEDWIDMLPRLRKGLDGKIEKILRVGYDELSNKDDKAIFRLIACLFNGAEISYIKLLLADSNLGVTIGLKNLVDKSLIRIGCDTVEMHSMLQEMGREIVREQSIYEPGEREFLVDSTDILDVLNDNTGTKKVLGISFDMSEIEELHIHKRAFKRMPNLRFLRFYKKLGKQSKEARLHLQEGFDKFFPPKLKLLSWDDYPMRRMPSNFHAGYLVVLRMQHSKLEKLWQGVQPLTCLREMQLWGSKKLKEIPDLSLATNLETLYLNDCSSLVELPSSIKNLNKLWDLGMKGCEKLELLPTDINLKSLYRLDLGRCSRLKSFPDISSNISELYLNRTAIEEVPWWIQKFSRLKRLRMRECKKLKCISPNISKLKHLEMLDFSNCIATTEEEALVQQQSVLKYLIFPGGQVPLYFTYQATGSSLAIPLSLHQSSLSQQLLGFRACVVLDAESMSSELYVIDIKVCCRLSGKRSNLFDSADCRDAFFTPQMDSHLVIFDCCFPLNQDNVRLAELNNDKVVTEFHFTSISRCKITGVGVRFLRDCSLPENHHNDPNILAPNCGCPETEHSDEYGEFGVETKRSRKRKRITLRTAQETIDLPYLQIREEQRM

superfamily: SSF52540
63-441 SSF52540

SRIAIVVFSKNYAASSWCLDELLEIVKCKEEFGQIVIPVFYGLDPCHVRKQSGEFGIVFENTCQTKTDDEIQKWRRALTDVANILGFHSSNWDNEATMVEDIANDVLAKLNLTTTSNDFEGFVGIEGHIAKISLMLCLECKQVRMFGIWGPSGIGKTTIARALFSRISRHFQGSVFLDRAFVSKSMEIYSGGNVDNYNAKLHLQGKFLSEILRAKDIKISNLGVVGERLKHMKVLIFIDDLDDQVVLDALASKPHWFGCGSRIIVITKDKQFFRAHGIGLFYEVGLPSDKLALEMFSQSAFRQNSPPPGFTELASEVSKRSGNLPLALNVLGSHLRGRDKEDWIDMLPRLRKGLDGKIEKILRVGYDELSNKDDKAIFR

HMMPfam: PF00931
IPR002182
188-453 NB-ARC,NBS
NB-ARC

EGHIAKISLMLCLECKQVRMFGIWGPSGIGKTTIARALFSRISRHFQGSVFLDRAFVSKSMEIYSGGNVDNYNAKLHLQGKFLSEILRAKDIKISNLGVVGERLKHMKVLIFIDDLDDQVVLDALASKPHWFGCGSRIIVITKDKQFFRAHGIGLFYEVGLPSDKLALEMFSQSAFRQNSPPPGFTELASEVSKRSGNLPLALNVLGSHLRGRDKEDWIDMLPRLRKGLDGKIEKILRVGYDELSNKDDKAIFRLIACLFNGAEIS

Gene3D: G3DSA:3.40.50.300
200-220 G3DSA:3.40.50.300

LECKQVRMFGIWGPSGIGKTT

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

MFGIWGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
221-360 G3DSA:3.40.50.300

IARALFSRISRHFQGSVFLDRAFVSKSMEIYSGGNVDNYNAKLHLQGKFLSEILRAKDIKISNLGVVGERLKHMKVLIFIDDLDDQVVLDALASKPHWFGCGSRIIVITKDKQFFRAHGIGLFYEVGLPSDKLALEMFSQ

FPrintScan: PR00364
IPR000767
290-304 DISEASERSIST
Disease resistance protein

RLKHMKVLIFIDDLD

FPrintScan: PR00364
IPR000767
383-397 DISEASERSIST
Disease resistance protein

SGNLPLALNVLGSHL

superfamily: SSF52058
487-805 SSF52058,LRR

EMHSMLQEMGREIVREQSIYEPGEREFLVDSTDILDVLNDNTGTKKVLGISFDMSEIEELHIHKRAFKRMPNLRFLRFYKKLGKQSKEARLHLQEGFDKFFPPKLKLLSWDDYPMRRMPSNFHAGYLVVLRMQHSKLEKLWQGVQPLTCLREMQLWGSKKLKEIPDLSLATNLETLYLNDCSSLVELPSSIKNLNKLWDLGMKGCEKLELLPTDINLKSLYRLDLGRCSRLKSFPDISSNISELYLNRTAIEEVPWWIQKFSRLKRLRMRECKKLKCISPNISKLKHLEMLDFSNCIATTEEEALVQQQSVLKYLIFPG

Gene3D: G3DSA:3.40.50.300
528-539 G3DSA:3.40.50.300

TGTKKVLGISFD

Gene3D: G3DSA:3.80.10.10
540-785 G3DSA:3.80.10.10

MSEIEELHIHKRAFKRMPNLRFLRFYKKLGKQSKEARLHLQEGFDKFFPPKLKLLSWDDYPMRRMPSNFHAGYLVVLRMQHSKLEKLWQGVQPLTCLREMQLWGSKKLKEIPDLSLATNLETLYLNDCSSLVELPSSIKNLNKLWDLGMKGCEKLELLPTDINLKSLYRLDLGRCSRLKSFPDISSNISELYLNRTAIEEVPWWIQKFSRLKRLRMRECKKLKCISPNISKLKHLEMLDFSNCIAT

HMMPfam: PF07725
IPR011713
612-631 LRR_3
Leucine-rich repeat 3

YLVVLRMQHSKLEKLWQGVQ

HMMPfam: PF00560
IPR001611
658-680 LRR_1
Leucine-rich repeat

NLETLYLNDCSSLVELPSSIKNL

FPrintScan: PR00364
IPR000767
701-717 DISEASERSIST
Disease resistance protein

INLKSLYRLDLGRCSRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox