PRGDB00046982 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42568185 (NM_123246)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G38850) mRNA, complete cds.

DNA Sequence

ATGGCTTCTGCTCGAACTTGGAGATACAACGTCTTCCCGAGCTTCCATGGAGGAGATATTCGTAAGACTTTTCTCTCTCATTTACGTAAGCAGTTCAACTCAAATGGGATTACAATGTTTGATGATCAAGGAATCGAGAGGAGCCAAACCATAGCCCCTGCTCTCATACAAGCGATTAGAGAATCTAGGATATCGATTGTGGTTCTTTCAAAGAACTATGCTTCTTCGAGTTGGTGCTTGAATGAATTGGTGGAGATTTTGAAATGCAAAGACGTAGTGATGCCGATCTTCTATGAAGTAGATCCATCCGATGTACGGAAACAGACCGGAGATTTTGGGAAGGCCTTCAAAAATAGTTGTAAAAGTAAAACTAAGGAGGAGAGGCAGAGATGGATCCAAGCTTTAATTTTTGTTGGCAACATAGCTGGAGAACACTCGCTGAAATGGGAAAATGAAGCGGATATGATTGAAAAGATAGCCAAAGATGTTTCAGATAAACTGAATGCTACACCTTCTAAAGATTTTGATGCATTTGTGGGACTTGAGTTTCACATTAGGGAATTAAGTTCTCTGCTATACCTAGACTATGAGCAAGTGAGGATAGTAGGAATCTGTGGCCCTGCAGGAATCGGTAAGACTACCATTGCTCGTGCTTTACAAAGCCTACTCTCTAGCAATTTTCAGCGAAGTTGTTTTATGGAGAATGTTAGGGGAAGTCTTAATATTGGGCTTGACGAGTATGGTCTGAAGTTAGATTTACAAGAACGACTTCTTTCAAAGATTATGAACCAAAAGGGTATGAGGATAGAGCATTTAGGCACAATAAGAGATAGGTTACATGACCAAAAAGTGCTTATCATTCTAGATGATGTTAATGATCTCGATTTGTATGCTTTGGCTGATCAGACAACGTGGTTTGGTCCTGGAAGTAGGATTATCGTGACAACAGAAGACAACGAGCTTTTGCAGAAACATGATATTAACAATGTCTACCATGTGGATTTTCCATCTAGAAAAGAAGCTCTTGAGATCTTTTGCAGATGTGCTTTTAGACAAAGCTCTGCACCTGATACGATTCTAAAGCTTGCAGAACGAGTAACAGAGCTTTGTGGTAATCTTCCATTGGGTCTCTGTGTCATAGGTTCATCTTTACACGGGAAAACTGAGGATGAGTGGGAAATTTTAATTCGCAGACTAGAAATTAGTCTTGATCGAGATAACGAGGCACAACTTAGAGTTGGGTATGATAGCTTACATGAGAACGAGCAAGCTTTATTTCTCAGCATTGCAGTCTTCTTCAACTATAAAGACCGTCAGCTTGTGATGGCCATGCTCCTTGACAGTAACCTAGATGTCGAGTATGGGTTAAGAACCCTCGCCAATAAATCTCTAATACATATATCTAGGAATGAGAAAATAGTGATGCATAACTTACTACAACATGTGGGTAGACAAGCCATTCAAAGACAAGAACCTTGGAAACGCCACATCTTAATAGATGCTGACGAGATATGCAATGTCCTTGAAAATGATACAGATGCTAGAATTGTGTCAGGGATATCATTTGATATATCCAGAATCGGCGAAGTTTTTTTAAGCGAGAGAGCTTTTAAAAGATTGTGTAATCTCCAATTCCTCAGGGTGTTTAAGACTGGATATGATGAAAAAAACAGAGTGCGCATACCGGAGAACATGGAGTTTCCACCTCGTCTAAGGTTACTACAGTGGGAAGCATATCCGAGGAGAAGTCTTTCTCTTAAACTTAACCTGGAATATCTTGTCGAACTTGATATGGAAGGTAGCCTGCTCGAGAAGCTATGGGATGGAACTCAGCCCCTTGCAAATCTCAAGAAGATGTCTTTGTCAAGTTCATGGTATTTAAAGAAACTTCCGGATCTGTCAAATGCTACAAATCTCGAAGAATTGGATCTGAGAGCTTGCCAGAATTTAGTAGAGCTTCCTTCCTCCTTTTCTTATCTGCATAAGCTAAAGTATTTGAATATGATGGGATGCAGAAGGCTAAAAGAAGTTCCACCTCATATCAACTTGAAGTCTCTTGAATTGGTCAACATGTATGGATGCTCAAGATTAAAAAGCTTTCCAGATATTTCTACAAACATCAGTTCACTCGACATATCATACACTGATGTGGAAGAACTACCTGAATCAATGACGATGTGGTCTCGCCTACGTACTCTCGAAATATACAAAAGTAGAAACCTCAAGATAGTAACACATGTGCCCCTAAACCTAACATATCTAGACCTCAGCGAGACTAGAATTGAGAAGATTCCAGATGACATCAAAAATGTTCATGGGCTGCAAATTTTATTTCTAGGTGGCTGCAGAAAACTCGCATCATTGCCAGAGCTTCCTGGTTCGCTCTTGTACTTATCAGCAAACGAGTGTGAATCACTTGAGAGCGTATCTTGCCCTTTTAATACTTCATACATGGAACTCAGCTTCACCAACTGCTTCAAACTAAACCAAGAAGCACGCAGAGGAATTATTCAACAATCATTTTCTCATGGGTGGGCATCCTTACCTGGAAGAGAGTTGCCCACTGACTTATACCACCGATCTACCGGACATTCCATCACCGTTCGTCTCGAGGGCAAGACTCCTTTTTCTGCATTCTTTGGATTTAAGGTTTTCCTCGTGATTTCCCCTAACCATGATGCTGAAGAAACTAGCAATTCTCCCTTATTTTGTCCTCGCATTGGCAAAATCGGTTGCTCCGATGACGAAACACCTATTTATATTATCCCCAAACCTCGAGCAGAACATCTAGTTATGTTTCACTCTGACTTGCATAACAAGGAAAAATGTCATGAAGTAGGCAACGAGATACTGTTTGAATTCAGCAACATATCCGACACCTATGAGATTATTGAGTGTGGTGTCAGATTCTATACAGATGAACAGGTGAAATCAGTGAAAGGAGAAATGAATATGAAATAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASARTWRYNVFPSFHGGDIRKTFLSHLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRWIQALIFVGNIAGEHSLKWENEADMIEKIAKDVSDKLNATPSKDFDAFVGLEFHIRELSSLLYLDYEQVRIVGICGPAGIGKTTIARALQSLLSSNFQRSCFMENVRGSLNIGLDEYGLKLDLQERLLSKIMNQKGMRIEHLGTIRDRLHDQKVLIILDDVNDLDLYALADQTTWFGPGSRIIVTTEDNELLQKHDINNVYHVDFPSRKEALEIFCRCAFRQSSAPDTILKLAERVTELCGNLPLGLCVIGSSLHGKTEDEWEILIRRLEISLDRDNEAQLRVGYDSLHENEQALFLSIAVFFNYKDRQLVMAMLLDSNLDVEYGLRTLANKSLIHISRNEKIVMHNLLQHVGRQAIQRQEPWKRHILIDADEICNVLENDTDARIVSGISFDISRIGEVFLSERAFKRLCNLQFLRVFKTGYDEKNRVRIPENMEFPPRLRLLQWEAYPRRSLSLKLNLEYLVELDMEGSLLEKLWDGTQPLANLKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPLNLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSLLYLSANECESLESVSCPFNTSYMELSFTNCFKLNQEARRGIIQQSFSHGWASLPGRELPTDLYHRSTGHSITVRLEGKTPFSAFFGFKVFLVISPNHDAEETSNSPLFCPRIGKIGCSDDETPIYIIPKPRAEHLVMFHSDLHNKEKCHEVGNEILFEFSNISDTYEIIECGVRFYTDEQVKSVKGEMNMK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SARTWRYNVFPSFHGGDIRKTFLSHLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRWIQALIFVGNIAGE

Gene3D: G3DSA:3.40.50.10140
5-131 G3DSA:3.40.50.10140

RTWRYNVFPSFHGGDIRKTFLSHLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRW

ProfileScan: PS50104
IPR000157
7-141 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRYNVFPSFHGGDIRKTFLSHLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRWIQALIFVGNI

HMMSmart: SM00255
IPR000157
8-141 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYNVFPSFHGGDIRKTFLSHLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRWIQALIFVGNI

HMMPfam: PF01582
IPR000157
11-135 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGGDIRKTFLSHLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRWIQAL

HMMPanther: PTHR11017
27-975 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRWIQALIFVGNIAGEHSLKWENEADMIEKIAKDVSDKLNATPSKDFDAFVGLEFHIRELSSLLYLDYEQVRIVGICGPAGIGKTTIARALQSLLSSNFQRSCFMENVRGSLNIGLDEYGLKLDLQERLLSKIMNQKGMRIEHLGTIRDRLHDQKVLIILDDVNDLDLYALADQTTWFGPGSRIIVTTEDNELLQKHDINNVYHVDFPSRKEALEIFCRCAFRQSSAPDTILKLAERVTELCGNLPLGLCVIGSSLHGKTEDEWEILIRRLEISLDRDNEAQLRVGYDSLHENEQALFLSIAVFFNYKDRQLVMAMLLDSNLDVEYGLRTLANKSLIHISRNEKIVMHNLLQHVGRQAIQRQEPWKRHILIDADEICNVLENDTDARIVSGISFDISRIGEVFLSERAFKRLCNLQFLRVFKTGYDEKNRVRIPENMEFPPRLRLLQWEAYPRRSLSLKLNLEYLVELDMEGSLLEKLWDGTQPLANLKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPLNLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSLLYLSANECESLESVSCPFNTSYMELSFTNCFKLNQEARRGIIQQSFSHGWASLPGRELPTDLYHRSTGHSITVRLEGKTPFSAFFGFKVFLVISPNHDAEETSNSPLFCPRIGKIGCSDDETPIYIIPKPRAEHLVMFHSDLHNKEKCHEVGNEILFEFSNISDTYEIIECGVRFYTDEQ

HMMPanther: PTHR11017:SF20
27-975 PTHR11017:SF20,SUBFAMILY NOT NAMED

HLRKQFNSNGITMFDDQGIERSQTIAPALIQAIRESRISIVVLSKNYASSSWCLNELVEILKCKDVVMPIFYEVDPSDVRKQTGDFGKAFKNSCKSKTKEERQRWIQALIFVGNIAGEHSLKWENEADMIEKIAKDVSDKLNATPSKDFDAFVGLEFHIRELSSLLYLDYEQVRIVGICGPAGIGKTTIARALQSLLSSNFQRSCFMENVRGSLNIGLDEYGLKLDLQERLLSKIMNQKGMRIEHLGTIRDRLHDQKVLIILDDVNDLDLYALADQTTWFGPGSRIIVTTEDNELLQKHDINNVYHVDFPSRKEALEIFCRCAFRQSSAPDTILKLAERVTELCGNLPLGLCVIGSSLHGKTEDEWEILIRRLEISLDRDNEAQLRVGYDSLHENEQALFLSIAVFFNYKDRQLVMAMLLDSNLDVEYGLRTLANKSLIHISRNEKIVMHNLLQHVGRQAIQRQEPWKRHILIDADEICNVLENDTDARIVSGISFDISRIGEVFLSERAFKRLCNLQFLRVFKTGYDEKNRVRIPENMEFPPRLRLLQWEAYPRRSLSLKLNLEYLVELDMEGSLLEKLWDGTQPLANLKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPLNLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSLLYLSANECESLESVSCPFNTSYMELSFTNCFKLNQEARRGIIQQSFSHGWASLPGRELPTDLYHRSTGHSITVRLEGKTPFSAFFGFKVFLVISPNHDAEETSNSPLFCPRIGKIGCSDDETPIYIIPKPRAEHLVMFHSDLHNKEKCHEVGNEILFEFSNISDTYEIIECGVRFYTDEQ

Gene3D: G3DSA:3.40.50.300
150-363 G3DSA:3.40.50.300

ENEADMIEKIAKDVSDKLNATPSKDFDAFVGLEFHIRELSSLLYLDYEQVRIVGICGPAGIGKTTIARALQSLLSSNFQRSCFMENVRGSLNIGLDEYGLKLDLQERLLSKIMNQKGMRIEHLGTIRDRLHDQKVLIILDDVNDLDLYALADQTTWFGPGSRIIVTTEDNELLQKHDINNVYHVDFPSRKEALEIFCRCAFRQSSAPDTILKLA

superfamily: SSF52540
161-399 SSF52540

KDVSDKLNATPSKDFDAFVGLEFHIRELSSLLYLDYEQVRIVGICGPAGIGKTTIARALQSLLSSNFQRSCFMENVRGSLNIGLDEYGLKLDLQERLLSKIMNQKGMRIEHLGTIRDRLHDQKVLIILDDVNDLDLYALADQTTWFGPGSRIIVTTEDNELLQKHDINNVYHVDFPSRKEALEIFCRCAFRQSSAPDTILKLAERVTELCGNLPLGLCVIGSSLHGKTEDEWEILIRRL

HMMPfam: PF00931
IPR002182
184-437 NB-ARC,NBS
NB-ARC

HIRELSSLLYLDYEQVRIVGICGPAGIGKTTIARALQSLLSSNFQRSCFMENVRGSLNIGLDEYGLKLDLQERLLSKIMNQKGMRIEHLGTIRDRLHDQKVLIILDDVNDLDLYALADQTTWFGPGSRIIVTTEDNELLQKHDINNVYHVDFPSRKEALEIFCRCAFRQSSAPDTILKLAERVTELCGNLPLGLCVIGSSLHGKTEDEWEILIRRLEISLDRDNEAQLRVGYDSLHENEQALFLSIAVFFNYKD

HMMSmart: SM00382
IPR003593
198-407 AAA,NBS
AAA+ ATPase domain

QVRIVGICGPAGIGKTTIARALQSLLSSNFQRSCFMENVRGSLNIGLDEYGLKLDLQERLLSKIMNQKGMRIEHLGTIRDRLHDQKVLIILDDVNDLDLYALADQTTWFGPGSRIIVTTEDNELLQKHDINNVYHVDFPSRKEALEIFCRCAFRQSSAPDTILKLAERVTELCGNLPLGLCVIGSSLHGKTEDEWEILIRRLEISLDRDN

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

IVGICGPAGIGKTTIA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

RLHDQKVLIILDDVN

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CGNLPLGLCVIGSSL

superfamily: SSF46785
405-509 SSF46785

RDNEAQLRVGYDSLHENEQALFLSIAVFFNYKDRQLVMAMLLDSNLDVEYGLRTLANKSLIHISRNEKIVMHNLLQHVGRQAIQRQEPWKRHILIDADEICNVLE

superfamily: SSF52058
504-828 SSF52058,LRR

ICNVLENDTDARIVSGISFDISRIGEVFLSERAFKRLCNLQFLRVFKTGYDEKNRVRIPENMEFPPRLRLLQWEAYPRRSLSLKLNLEYLVELDMEGSLLEKLWDGTQPLANLKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPLNLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSLLYLSANECESLESVSCPFNTSYMELSFTNCFKL

Gene3D: G3DSA:3.80.10.10
522-824 G3DSA:3.80.10.10

FDISRIGEVFLSERAFKRLCNLQFLRVFKTGYDEKNRVRIPENMEFPPRLRLLQWEAYPRRSLSLKLNLEYLVELDMEGSLLEKLWDGTQPLANLKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPLNLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSLLYLSANECESLESVSCPFNTSYMELSFTN

HMMPfam: PF07725
IPR011713
592-611 LRR_3
Leucine-rich repeat 3

YLVELDMEGSLLEKLWDGTQ

ProfileScan: PS51450
IPR001611
615-637 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKKMSLSSSWYLKKLPDLSNAT

FPrintScan: PR00364
IPR000767
634-650 DISEASERSIST
Disease resistance protein

SNATNLEELDLRACQNL

HMMPfam: PF13855
637-694 LRR_8,Leucine rich repeat

TNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGC

ProfileScan: PS51450
IPR001611
638-660 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELDLRACQNLVELPSSFSYL

ProfileScan: PS51450
IPR001611
662-684 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKYLNMMGCRRLKEVPPHINLK

HMMPfam: PF00560
IPR001611
750-770 LRR_1
Leucine-rich repeat

NLTYLDLSETRIEKIPDDIKN

ProfileScan: PS51450
IPR001611
750-771 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTYLDLSETRIEKIPDDIKNV

ProfileScan: PS51450
IPR001611
773-795 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQILFLGGCRKLASLPELPGSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox