PRGDB00046983 (disease resistance protein (NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18421748 (NM_123196)
Gene Class NL
Domain Type LRR, LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (NBS-LRR class), putative (AT5G38350) mRNA, complete cds.

DNA Sequence

ATGACCGAAAAGATCGCTACAGATGTTTCTAACATGCTGAATAATTACTCACCGTCAAGAGATTTTGATGGTTTGATTGGGATGGATGCTCATATGAAAGAAATGGAATCGTTGTTATGCCTAGACTCTGATGAAGTAAGGATGATTGGGATTTGGGGTCCGTCTGGGATTGGGAAGACCACCATTGCCAGAGTCTTATATAGCCAATTTTCTGAAAATTTTGAATTGAGTATCTTCATGGGGAATATCAAAGAGTTGATGTATACAAGACCAGTGTGTTCTGATGAGTATAGTGCGAAGATTCAGTTACAGAAACAATTTTTATCCCAAATAATCAACCACAAGGATATGGAGCTTCATCATTTAGGAGTTGCACAGGATAGGTTGAACGACAAGAAAGTGCTTATTGTTCTCGATAGCATTGATCAGTCAATACAACTAGATGCTATTGCAAAAGAAACTCGGTGGTTTGGCCATGGAAGTCGGATTATCATCACAACACAAGACCAAAAACTTTTGAAGGCACATGGAATCAACCATATTTACAAGGTGGAGTTTCCATCAGCATATGAAGCTTATCAGATGTTTTGTATGTATGCTTTTGGCCAAAACTTCCCTAATGATGGTTTCGAGGAGCTTGCTTGGGAAGTTACAAAACTTTTAGGTCATCTACCTTTGGGACTAAGAGTTATGGGTTCCCACTTCCGAGGAATGTCTAGGCATGAGTGGGTAAATGCTTTACCAAGGTTAAAGATTCGCCTTGATGCTAGTATTCAAAGCATTTTAAAGTTCAGTTACGATGCCTTATGTGAGGAAGATAAAGATTTGTTCCTTCATATAGCTTGCCTTTTCAACAATCAAGAAATGGTGGAAGTTGAAGATTATCTTGCTTTAAGTTTCTTGGACGTGAGGCAAGGGTTTCACCTCTTAGCCGAGAAATCTCTCATAAATCTTAAGTTTTTATCTACTAACTGTACACGTATAGAGATGCACAATCTACTAGTGCAATTAGGTAAAGACATTGTTCGTCATAAGCCTGGGCACCAATCCATTTGTGAGCCTGGGAAGCGTCAATTTTTGATTGATGCTAGAGATATTTGTGAAGTACTCACTGATAACACGGGTAATAGAAATGTTGTAGGTATATTTTTGGAAGTAAGAAACCTATCATGCCAATTAAATATAAGTGAGAGAGCTTTTGACGGAATGTCAAACCTTAAATTCTTAAGATTCCATGACCCATATGACGACGAAAGTGATAAATTGTACTTGCCACAAGGGTTGAATAATCTACCTCAGAAACTTAGATTAATAGAATGGAGCCGGTTTCCGATGACTTGTTTGCCTTCTAATTTTTGTACGAAGTATCTAGTCGAGATACGTATGAAGAACAGCAAACTTCAGAACTTGTGGCAAGGAAATCAGCCCCTTGGAAATCTCAAGAGGATGGATTTGAGTGAGTCGAAACACCTAAAAGAACTACCTGATCTCTCAACTGCCACTAACCTTGAATATTTGATTATGTCTGGATGCATAAGTTTGGTGGAGCTCCCCTCCTCTATTGGAAAGCTTCGTAAATTGCTAATGTTGAGTTTACGAGGCTGCTCAAAGCTAGAGGCTCTTCCAACCAATATCAACTTGGAATCTCTCGATTACCTTGATCTCACTGATTGCTTATTGATCAAAAAATTTCCTGAGATCTCTACAAACATTAAGGATCTCAAGCTCACGAAAACTGCAATAAAAGAGGTACCTTCGACGATCAAGTCATGGTCTCATCTTCGTAAACTGGAAATGTCATACAGTGAAAACCTCAAGGAACTCCCGCATGCTCTTGATATCATCACAACGCTGTACATTAACGATACAGAAATGCAAGAAATTCCTCAGTGGGTTAAGAAAATCTCTCATCTTCAGACACTTGGGCTAGAGGGATGCAAGAGGCTGGTAACAATCCCACAACTTTCAGATTCCCTATCACAACTAGTGGTAACAAACTGTGAGTCATTGGAGAGACTTAATTTCTCCTTTCAAAATCATCCAGAGAGATTTCTCTGGTTTCTAAATTGCTTCAAGCTAAATAATGAAGCGAGAGAATTCATCCAAACTAGTAGTACCCATGCGATCTTACCTAGTAGAGAAGTGCCTGCAAACTTCACTTACCGAGCTAATGGGAGTTCCATAATGGTAAATCTGAATCATAGGCCTCTTTCTACAACTTTGAGATTTAAGGCTTGCGTCTTGCTAGTTAAAAAAATTGACAATGATAAGGAGGAGGCCGCTGATAGGAGAACAACTGTAATTCCTAGAATCAGGGAGAACGATAAAATTGGCGTCGATGTTCCATGGAGATATCGCTTTCACGTGCCTACCATTTTAGAAGACCATTTGCTCACCTTCCAAATTGAAGCTGATGTGACGTCCAACAAGCTTTTATTTTCGTTCGACATCAAGGACAACAACCAAGCGGTGATTAAAGAATGTGGAGTACTCCAACTCTAA


Protein sequences

Name Description Sequence
disease resistance protein (NBS-LRR class), putative disease resistance protein (NBS-LRR class), putative [Arabidopsis thaliana].

MTEKIATDVSNMLNNYSPSRDFDGLIGMDAHMKEMESLLCLDSDEVRMIGIWGPSGIGKTTIARVLYSQFSENFELSIFMGNIKELMYTRPVCSDEYSAKIQLQKQFLSQIINHKDMELHHLGVAQDRLNDKKVLIVLDSIDQSIQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVEFPSAYEAYQMFCMYAFGQNFPNDGFEELAWEVTKLLGHLPLGLRVMGSHFRGMSRHEWVNALPRLKIRLDASIQSILKFSYDALCEEDKDLFLHIACLFNNQEMVEVEDYLALSFLDVRQGFHLLAEKSLINLKFLSTNCTRIEMHNLLVQLGKDIVRHKPGHQSICEPGKRQFLIDARDICEVLTDNTGNRNVVGIFLEVRNLSCQLNISERAFDGMSNLKFLRFHDPYDDESDKLYLPQGLNNLPQKLRLIEWSRFPMTCLPSNFCTKYLVEIRMKNSKLQNLWQGNQPLGNLKRMDLSESKHLKELPDLSTATNLEYLIMSGCISLVELPSSIGKLRKLLMLSLRGCSKLEALPTNINLESLDYLDLTDCLLIKKFPEISTNIKDLKLTKTAIKEVPSTIKSWSHLRKLEMSYSENLKELPHALDIITTLYINDTEMQEIPQWVKKISHLQTLGLEGCKRLVTIPQLSDSLSQLVVTNCESLERLNFSFQNHPERFLWFLNCFKLNNEAREFIQTSSTHAILPSREVPANFTYRANGSSIMVNLNHRPLSTTLRFKACVLLVKKIDNDKEEAADRRTTVIPRIRENDKIGVDVPWRYRFHVPTILEDHLLTFQIEADVTSNKLLFSFDIKDNNQAVIKECGVLQL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-833 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MTEKIATDVSNMLNNYSPSRDFDGLIGMDAHMKEMESLLCLDSDEVRMIGIWGPSGIGKTTIARVLYSQFSENFELSIFMGNIKELMYTRPVCSDEYSAKIQLQKQFLSQIINHKDMELHHLGVAQDRLNDKKVLIVLDSIDQSIQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVEFPSAYEAYQMFCMYAFGQNFPNDGFEELAWEVTKLLGHLPLGLRVMGSHFRGMSRHEWVNALPRLKIRLDASIQSILKFSYDALCEEDKDLFLHIACLFNNQEMVEVEDYLALSFLDVRQGFHLLAEKSLINLKFLSTNCTRIEMHNLLVQLGKDIVRHKPGHQSICEPGKRQFLIDARDICEVLTDNTGNRNVVGIFLEVRNLSCQLNISERAFDGMSNLKFLRFHDPYDDESDKLYLPQGLNNLPQKLRLIEWSRFPMTCLPSNFCTKYLVEIRMKNSKLQNLWQGNQPLGNLKRMDLSESKHLKELPDLSTATNLEYLIMSGCISLVELPSSIGKLRKLLMLSLRGCSKLEALPTNINLESLDYLDLTDCLLIKKFPEISTNIKDLKLTKTAIKEVPSTIKSWSHLRKLEMSYSENLKELPHALDIITTLYINDTEMQEIPQWVKKISHLQTLGLEGCKRLVTIPQLSDSLSQLVVTNCESLERLNFSFQNHPERFLWFLNCFKLNNEAREFIQTSSTHAILPSREVPANFTYRANGSSIMVNLNHRPLSTTLRFKACVLLVKKIDNDKEEAADRRTTVIPRIRENDKIGVDVPWRYRFHVPTILEDHLLTFQIEADVTSNKLLFSFDIKDNNQAVIKECGVLQL

HMMPanther: PTHR11017:SF20
1-833 PTHR11017:SF20,SUBFAMILY NOT NAMED

MTEKIATDVSNMLNNYSPSRDFDGLIGMDAHMKEMESLLCLDSDEVRMIGIWGPSGIGKTTIARVLYSQFSENFELSIFMGNIKELMYTRPVCSDEYSAKIQLQKQFLSQIINHKDMELHHLGVAQDRLNDKKVLIVLDSIDQSIQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVEFPSAYEAYQMFCMYAFGQNFPNDGFEELAWEVTKLLGHLPLGLRVMGSHFRGMSRHEWVNALPRLKIRLDASIQSILKFSYDALCEEDKDLFLHIACLFNNQEMVEVEDYLALSFLDVRQGFHLLAEKSLINLKFLSTNCTRIEMHNLLVQLGKDIVRHKPGHQSICEPGKRQFLIDARDICEVLTDNTGNRNVVGIFLEVRNLSCQLNISERAFDGMSNLKFLRFHDPYDDESDKLYLPQGLNNLPQKLRLIEWSRFPMTCLPSNFCTKYLVEIRMKNSKLQNLWQGNQPLGNLKRMDLSESKHLKELPDLSTATNLEYLIMSGCISLVELPSSIGKLRKLLMLSLRGCSKLEALPTNINLESLDYLDLTDCLLIKKFPEISTNIKDLKLTKTAIKEVPSTIKSWSHLRKLEMSYSENLKELPHALDIITTLYINDTEMQEIPQWVKKISHLQTLGLEGCKRLVTIPQLSDSLSQLVVTNCESLERLNFSFQNHPERFLWFLNCFKLNNEAREFIQTSSTHAILPSREVPANFTYRANGSSIMVNLNHRPLSTTLRFKACVLLVKKIDNDKEEAADRRTTVIPRIRENDKIGVDVPWRYRFHVPTILEDHLLTFQIEADVTSNKLLFSFDIKDNNQAVIKECGVLQL

superfamily: SSF52540
8-258 SSF52540

DVSNMLNNYSPSRDFDGLIGMDAHMKEMESLLCLDSDEVRMIGIWGPSGIGKTTIARVLYSQFSENFELSIFMGNIKELMYTRPVCSDEYSAKIQLQKQFLSQIINHKDMELHHLGVAQDRLNDKKVLIVLDSIDQSIQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVEFPSAYEAYQMFCMYAFGQNFPNDGFEELAWEVTKLLGHLPLGLRVMGSHFRGMSRHEWVNALPRLKIRLDASI

Gene3D: G3DSA:3.40.50.300
12-59 G3DSA:3.40.50.300

MLNNYSPSRDFDGLIGMDAHMKEMESLLCLDSDEVRMIGIWGPSGIGK

HMMPfam: PF00931
IPR002182
30-290 NB-ARC,NBS
NB-ARC

AHMKEMESLLCLDSDEVRMIGIWGPSGIGKTTIARVLYSQFSENFELSIFMGNIKELMYTRPVCSDEYSAKIQLQKQFLSQIINHKDMELHHLGVAQDRLNDKKVLIVLDSIDQSIQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVEFPSAYEAYQMFCMYAFGQNFPNDGFEELAWEVTKLLGHLPLGLRVMGSHFRGMSRHEWVNALPRLKIRLDASIQSILKFSYDALCEEDKDLFLHIACLFNNQEMV

FPrintScan: PR00364
IPR000767
48-63 DISEASERSIST
Disease resistance protein

MIGIWGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
60-76 G3DSA:3.40.50.300

TTIARVLYSQFSENFEL

FPrintScan: PR00364
IPR000767
128-142 DISEASERSIST
Disease resistance protein

RLNDKKVLIVLDSID

Gene3D: G3DSA:3.40.50.300
158-190 G3DSA:3.40.50.300

GHGSRIIITTQDQKLLKAHGINHIYKVEFPSAY

FPrintScan: PR00364
IPR000767
221-235 DISEASERSIST
Disease resistance protein

LGHLPLGLRVMGSHF

superfamily: SSF46785
256-371 SSF46785

ASIQSILKFSYDALCEEDKDLFLHIACLFNNQEMVEVEDYLALSFLDVRQGFHLLAEKSLINLKFLSTNCTRIEMHNLLVQLGKDIVRHKPGHQSICEPGKRQFLIDARDICEVLT

superfamily: SSF52058
394-693 SSF52058,LRR

NISERAFDGMSNLKFLRFHDPYDDESDKLYLPQGLNNLPQKLRLIEWSRFPMTCLPSNFCTKYLVEIRMKNSKLQNLWQGNQPLGNLKRMDLSESKHLKELPDLSTATNLEYLIMSGCISLVELPSSIGKLRKLLMLSLRGCSKLEALPTNINLESLDYLDLTDCLLIKKFPEISTNIKDLKLTKTAIKEVPSTIKSWSHLRKLEMSYSENLKELPHALDIITTLYINDTEMQEIPQWVKKISHLQTLGLEGCKRLVTIPQLSDSLSQLVVTNCESLERLNFSFQNHPERFLWFLNCFKL

Gene3D: G3DSA:3.80.10.10
436-677 G3DSA:3.80.10.10

RLIEWSRFPMTCLPSNFCTKYLVEIRMKNSKLQNLWQGNQPLGNLKRMDLSESKHLKELPDLSTATNLEYLIMSGCISLVELPSSIGKLRKLLMLSLRGCSKLEALPTNINLESLDYLDLTDCLLIKKFPEISTNIKDLKLTKTAIKEVPSTIKSWSHLRKLEMSYSENLKELPHALDIITTLYINDTEMQEIPQWVKKISHLQTLGLEGCKRLVTIPQLSDSLSQLVVTNCESLERLNFSF

HMMPfam: PF07725
IPR011713
456-475 LRR_3
Leucine-rich repeat 3

YLVEIRMKNSKLQNLWQGNQ

FPrintScan: PR00364
IPR000767
475-491 DISEASERSIST
Disease resistance protein

QPLGNLKRMDLSESKHL

HMMPfam: PF00560
IPR001611
502-524 LRR_1
Leucine-rich repeat

NLEYLIMSGCISLVELPSSIGKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox