PRGDB00046984 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422994 (NM_124291)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G49140) mRNA, complete cds.

DNA Sequence

ATGGCTCCATGTTCTTCGTCTGGCTCTAGTAGCTGTTGGAAGTATGACGTCTTCCCCAGCTTCCGAGGGGAAGATGTTCGCGGAAACTTTCTCAGCCACTTGATGAAAGAATTTGAAAGCAAGGGAATTGTTACATTCAAAGATGATCTAATCGAAAGAAGCCAGACAATCGGATTGGAGCTCAAAGAAGCCGTAAGACAATCTAAGATCTTTGTGGTGATATTCTCAAAGAACTATGCTTCTTCAAGCTGGTGTTTGGATGAGTTGGTTGAAATTTTAAAGTGCAAGGAGGAGAGGAGGCTAATACCGATTTTCTACAAAGTGAATCCATCCGATGTAAGAAATCAGACCGGGAAATTTGGGAGAGGCTTCCGAGAAACCTGTGAAGGGAAGAATGATGAGACACAAAATAAATGGAAGGCAGCCTTGACCGAAGCGGCAAATATAGCGGGAGAGGATTCACAAAGCTGGAAAAATGAGGCAGATTTTCTCACAAAAATCGCGAAAGATATATTGGCCAAACTCAATGGTACACCGTCAAATGATTTTGAAAACATAATTGGAATTGAATCCCATATGGAGAAAATGGTTCAATTATTATGTTTAAACGATGATGACGTTAGGATGGTTGGGATTTGGGGTCCCGCTGGTATTGGTAAGACCACCATCGCAAGGGTTTTACACAGCCGCTTTTCTGGTGACTTCCGCTTTACTGTTTTCATGGAGAACGTTAGGGGAAACTATCAAAGAATTGTCGATAGTGGCGGCGAGTACAACTTACAGGCTCGTTTACAAAAAGAGTTTTTGCCCATAATATTCAACCAAAAAGATAGGAAGATAAATCATCTATGGAAGATAGAAGAAAGGCTAAAGAAGCAAAAAGTTCTCATTGTTCTTGGTGATGTGGATAAGGTAGAGCAATTAGAAGCCTTAGCTAACGAGACACGCTGGTTTGGTCCTGGAAGTAGGATCATCGTTACCACCAAAGATAAACAGATATTGGTAGGACATGAGATAAACCATATATACGAGGTCAAATTACCATGCAGAAAAACAGCACTTGAGATCTTATGCCTCTATGCTTTCAAGCAAAATGTGGCACCAGATGATTTCATGGATGTGGTGGTTGAAGTAGCAGAGCTTTCTGGTCATCTTCCATTAGGTCTCCGTGTGTTAGGTTCTCATATGCGCGGAAAGAGCAAGGATCGGTGGAAACTTGAACTAGGAAGGCTCACAACTAGTCTTGACGAAAAGGTGGAGAAAATATTAAAAATCAGCTATGATGACTTACATATTAGGGATAAAGCTTTGTTCCTTCACATTGCATGTATGTTCAATGGTGAGAACATTGATCTTGTGAAGCAAATGCTTGTCAATAGTGACTTAGATGTGAGTCTTGGGCTCCAACTCTTGCTTGATAAATCTCTCATTCAAATAAATGATGATAGAGAAATAGTCATGCATAGTTTGTTACTAAAAATGGGAAAAGAAGTCGTTTGTCAGCATTCAAGCGAGCCTGGAAAACGTCAGTTCTTGTTCAATACAAAGGAGACTTGTAACATACTTTCAAATAATACAGGTTCAGAAGCAGTACTTGGCATATCATTAGATACATCTGAGATCCAAAACGATGTCTTCATGAGTGAGAGAGTTTTTGAAGACATGCGCAATCTAAAGTTCCTAAGATTCTACAACAAGAAAATTGATGAAAACCCAAGTTTGAAACTCCACCTACCTCGAGGGCTAAACTACTTGCCTGCTGTAAGATTATTACATTGGGATTCATATCCCATGAAGTATATTCCTTCTCAATTTCGTCCAGAATGCCTTGTGGAACTCCGCATGATGCATAGCAAAGTGGTGAAGCTTTGGGAAGGAACCCAGACGCTTGCATATCTCAAGACGATAGATTTGAGCTTCTCCAATAATTTAGTAGAAGTTCCGGATCTTTCAAAGGCAATAAGTCTCGAGACATTGTGTCTAGAAGGTTGCCAAAGTTTGGCGGAGCTTCCTTCCTCTGTCTTGAATCTTCATAGACTAAAATGGTTGAGGCTGACTATGTGTGAAAAGCTAGAAGTTATACCGCTTCACATCAATTTGGCATCTCTTGAGGTCCTTGACATGGAAGGATGCTTAAAATTGAAAAGTTTTCCAGATATTTCGAAGAACATCGAAAGAATCTTTATGAAAAACACAGGGATAGAAGAAATACCTCCATCAATTAGTCAATGGTCTCGCCTTGAATCCCTTGATATTAGTGGCTGCCTAAACCTCAAGATATTTTCACATGTCCCCAAGAGTGTAGTGTATATATACCTAACGGATAGCGGTATTGAAAGGCTTCCAGATTGTATCAAAGATCTCACTTGGCTACACTACTTATACGTCGATAATTGTAGAAAACTTGTGTCACTGCCAGAGCTTCCAAGTTCGATCAAGATTCTATCAGCAATAAATTGTGAATCACTTGAGAGAATATCTTCATCTTTCGACTGTCCAAATGCGAAAGTCGAGTTCAGCAAATCCATGAATTTCGATGGAGAAGCACGACGAGTAATCACGCAGCAATGGGTTTACAAGAGAGCATGCTTACCTGGCAAAGAGGTTCCTCTGGAGTTCAGTCACCGTGCCAGAGGAGGTTCCTTGACCATCCATCTAGAAGATGAAAATGTTTGTTCTTCATCTTTAAGATTTAAGGCTTGCATCCTACTTTTCCCAAGCGAAAGGAACAATATTTGTACTGTATATTGTCGTCTCATAGGTGAAAGTGGTCGTCTCATCGCAGCACATAGATTTGGTGGAGTTGTCAAGGACTTTGTCACACCGCATCTGTTTATATTTAACTCAGTCTTACTTGAAGAAGTGGATGTGATACGGTTTGGATTCAGCAGCATACACCACGAGATTACGGAATGTGGTGTACAAATATTGACAGATGCATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MAPCSSSGSSSCWKYDVFPSFRGEDVRGNFLSHLMKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALTEAANIAGEDSQSWKNEADFLTKIAKDILAKLNGTPSNDFENIIGIESHMEKMVQLLCLNDDDVRMVGIWGPAGIGKTTIARVLHSRFSGDFRFTVFMENVRGNYQRIVDSGGEYNLQARLQKEFLPIIFNQKDRKINHLWKIEERLKKQKVLIVLGDVDKVEQLEALANETRWFGPGSRIIVTTKDKQILVGHEINHIYEVKLPCRKTALEILCLYAFKQNVAPDDFMDVVVEVAELSGHLPLGLRVLGSHMRGKSKDRWKLELGRLTTSLDEKVEKILKISYDDLHIRDKALFLHIACMFNGENIDLVKQMLVNSDLDVSLGLQLLLDKSLIQINDDREIVMHSLLLKMGKEVVCQHSSEPGKRQFLFNTKETCNILSNNTGSEAVLGISLDTSEIQNDVFMSERVFEDMRNLKFLRFYNKKIDENPSLKLHLPRGLNYLPAVRLLHWDSYPMKYIPSQFRPECLVELRMMHSKVVKLWEGTQTLAYLKTIDLSFSNNLVEVPDLSKAISLETLCLEGCQSLAELPSSVLNLHRLKWLRLTMCEKLEVIPLHINLASLEVLDMEGCLKLKSFPDISKNIERIFMKNTGIEEIPPSISQWSRLESLDISGCLNLKIFSHVPKSVVYIYLTDSGIERLPDCIKDLTWLHYLYVDNCRKLVSLPELPSSIKILSAINCESLERISSSFDCPNAKVEFSKSMNFDGEARRVITQQWVYKRACLPGKEVPLEFSHRARGGSLTIHLEDENVCSSSLRFKACILLFPSERNNICTVYCRLIGESGRLIAAHRFGGVVKDFVTPHLFIFNSVLLEEVDVIRFGFSSIHHEITECGVQILTDA

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PCSSSGSSSCWKYDVFPSFRGEDVRGNFLSHLMKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALTEAANIAGE

Gene3D: G3DSA:3.40.50.10140
12-143 G3DSA:3.40.50.10140

CWKYDVFPSFRGEDVRGNFLSHLMKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAAL

ProfileScan: PS50104
IPR000157
13-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYDVFPSFRGEDVRGNFLSHLMKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALTEAANI

HMMSmart: SM00255
IPR000157
14-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFPSFRGEDVRGNFLSHLMKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALTEAANI

HMMPfam: PF01582
IPR000157
17-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFRGEDVRGNFLSHLMKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALT

HMMPanther: PTHR11017:SF20
35-980 PTHR11017:SF20,SUBFAMILY NOT NAMED

MKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALTEAANIAGEDSQSWKNEADFLTKIAKDILAKLNGTPSNDFENIIGIESHMEKMVQLLCLNDDDVRMVGIWGPAGIGKTTIARVLHSRFSGDFRFTVFMENVRGNYQRIVDSGGEYNLQARLQKEFLPIIFNQKDRKINHLWKIEERLKKQKVLIVLGDVDKVEQLEALANETRWFGPGSRIIVTTKDKQILVGHEINHIYEVKLPCRKTALEILCLYAFKQNVAPDDFMDVVVEVAELSGHLPLGLRVLGSHMRGKSKDRWKLELGRLTTSLDEKVEKILKISYDDLHIRDKALFLHIACMFNGENIDLVKQMLVNSDLDVSLGLQLLLDKSLIQINDDREIVMHSLLLKMGKEVVCQHSSEPGKRQFLFNTKETCNILSNNTGSEAVLGISLDTSEIQNDVFMSERVFEDMRNLKFLRFYNKKIDENPSLKLHLPRGLNYLPAVRLLHWDSYPMKYIPSQFRPECLVELRMMHSKVVKLWEGTQTLAYLKTIDLSFSNNLVEVPDLSKAISLETLCLEGCQSLAELPSSVLNLHRLKWLRLTMCEKLEVIPLHINLASLEVLDMEGCLKLKSFPDISKNIERIFMKNTGIEEIPPSISQWSRLESLDISGCLNLKIFSHVPKSVVYIYLTDSGIERLPDCIKDLTWLHYLYVDNCRKLVSLPELPSSIKILSAINCESLERISSSFDCPNAKVEFSKSMNFDGEARRVITQQWVYKRACLPGKEVPLEFSHRARGGSLTIHLEDENVCSSSLRFKACILLFPSERNNICTVYCRLIGESGRLIAAHRFGGVVKDFVTPHLFIFNSVLLEEVDVIRFGFSSIHHEITECGVQILTDA

HMMPanther: PTHR11017
35-980 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MKEFESKGIVTFKDDLIERSQTIGLELKEAVRQSKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALTEAANIAGEDSQSWKNEADFLTKIAKDILAKLNGTPSNDFENIIGIESHMEKMVQLLCLNDDDVRMVGIWGPAGIGKTTIARVLHSRFSGDFRFTVFMENVRGNYQRIVDSGGEYNLQARLQKEFLPIIFNQKDRKINHLWKIEERLKKQKVLIVLGDVDKVEQLEALANETRWFGPGSRIIVTTKDKQILVGHEINHIYEVKLPCRKTALEILCLYAFKQNVAPDDFMDVVVEVAELSGHLPLGLRVLGSHMRGKSKDRWKLELGRLTTSLDEKVEKILKISYDDLHIRDKALFLHIACMFNGENIDLVKQMLVNSDLDVSLGLQLLLDKSLIQINDDREIVMHSLLLKMGKEVVCQHSSEPGKRQFLFNTKETCNILSNNTGSEAVLGISLDTSEIQNDVFMSERVFEDMRNLKFLRFYNKKIDENPSLKLHLPRGLNYLPAVRLLHWDSYPMKYIPSQFRPECLVELRMMHSKVVKLWEGTQTLAYLKTIDLSFSNNLVEVPDLSKAISLETLCLEGCQSLAELPSSVLNLHRLKWLRLTMCEKLEVIPLHINLASLEVLDMEGCLKLKSFPDISKNIERIFMKNTGIEEIPPSISQWSRLESLDISGCLNLKIFSHVPKSVVYIYLTDSGIERLPDCIKDLTWLHYLYVDNCRKLVSLPELPSSIKILSAINCESLERISSSFDCPNAKVEFSKSMNFDGEARRVITQQWVYKRACLPGKEVPLEFSHRARGGSLTIHLEDENVCSSSLRFKACILLFPSERNNICTVYCRLIGESGRLIAAHRFGGVVKDFVTPHLFIFNSVLLEEVDVIRFGFSSIHHEITECGVQILTDA

superfamily: SSF52540
68-439 SSF52540

SKIFVVIFSKNYASSSWCLDELVEILKCKEERRLIPIFYKVNPSDVRNQTGKFGRGFRETCEGKNDETQNKWKAALTEAANIAGEDSQSWKNEADFLTKIAKDILAKLNGTPSNDFENIIGIESHMEKMVQLLCLNDDDVRMVGIWGPAGIGKTTIARVLHSRFSGDFRFTVFMENVRGNYQRIVDSGGEYNLQARLQKEFLPIIFNQKDRKINHLWKIEERLKKQKVLIVLGDVDKVEQLEALANETRWFGPGSRIIVTTKDKQILVGHEINHIYEVKLPCRKTALEILCLYAFKQNVAPDDFMDVVVEVAELSGHLPLGLRVLGSHMRGKSKDRWKLELGRLTTSLDEKVEKILKISYDDLHIRDKALFL

Gene3D: G3DSA:3.40.50.300
181-219 G3DSA:3.40.50.300

NDFENIIGIESHMEKMVQLLCLNDDDVRMVGIWGPAGIG

HMMPfam: PF00931
IPR002182
190-452 NB-ARC,NBS
NB-ARC

ESHMEKMVQLLCLNDDDVRMVGIWGPAGIGKTTIARVLHSRFSGDFRFTVFMENVRGNYQRIVDSGGEYNLQARLQKEFLPIIFNQKDRKINHLWKIEERLKKQKVLIVLGDVDKVEQLEALANETRWFGPGSRIIVTTKDKQILVGHEINHIYEVKLPCRKTALEILCLYAFKQNVAPDDFMDVVVEVAELSGHLPLGLRVLGSHMRGKSKDRWKLELGRLTTSLDEKVEKILKISYDDLHIRDKALFLHIACMFNGENIDL

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MVGIWGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
220-255 G3DSA:3.40.50.300

KTTIARVLHSRFSGDFRFTVFMENVRGNYQRIVDSG

Gene3D: G3DSA:3.40.50.300
265-333 G3DSA:3.40.50.300

QKEFLPIIFNQKDRKINHLWKIEERLKKQKVLIVLGDVDKVEQLEALANETRWFGPGSRIIVTTKDKQI

FPrintScan: PR00364
IPR000767
289-303 DISEASERSIST
Disease resistance protein

RLKKQKVLIVLGDVD

PatternScan: PS00142
334-343 ZINC_PROTEASE,Neutral zinc metallopeptidases

LVGHEINHIY

FPrintScan: PR00364
IPR000767
382-396 DISEASERSIST
Disease resistance protein

SGHLPLGLRVLGSHM

superfamily: SSF52058
497-837 SSF52058,LRR

EVVCQHSSEPGKRQFLFNTKETCNILSNNTGSEAVLGISLDTSEIQNDVFMSERVFEDMRNLKFLRFYNKKIDENPSLKLHLPRGLNYLPAVRLLHWDSYPMKYIPSQFRPECLVELRMMHSKVVKLWEGTQTLAYLKTIDLSFSNNLVEVPDLSKAISLETLCLEGCQSLAELPSSVLNLHRLKWLRLTMCEKLEVIPLHINLASLEVLDMEGCLKLKSFPDISKNIERIFMKNTGIEEIPPSISQWSRLESLDISGCLNLKIFSHVPKSVVYIYLTDSGIERLPDCIKDLTWLHYLYVDNCRKLVSLPELPSSIKILSAINCESLERISSSFDCPNAKV

Gene3D: G3DSA:3.80.10.10
575-821 G3DSA:3.80.10.10

KLHLPRGLNYLPAVRLLHWDSYPMKYIPSQFRPECLVELRMMHSKVVKLWEGTQTLAYLKTIDLSFSNNLVEVPDLSKAISLETLCLEGCQSLAELPSSVLNLHRLKWLRLTMCEKLEVIPLHINLASLEVLDMEGCLKLKSFPDISKNIERIFMKNTGIEEIPPSISQWSRLESLDISGCLNLKIFSHVPKSVVYIYLTDSGIERLPDCIKDLTWLHYLYVDNCRKLVSLPELPSSIKILSAINCE

HMMPfam: PF07725
IPR011713
609-628 LRR_3
Leucine-rich repeat 3

CLVELRMMHSKVVKLWEGTQ

FPrintScan: PR00364
IPR000767
698-714 DISEASERSIST
Disease resistance protein

INLASLEVLDMEGCLKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox