PRGDB00046985 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18414875 (NM_120622)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT5G05400) mRNA, complete cds.

DNA Sequence

ATGGGAGCCTGCTTCTCTGTGGCAATATCCTGTGACCAGGCTGTTAATAACCTTACAAGCTGCCTTAGCAGGAACCAAAATCGCTTCCGCAACCTCGTAGATCATGTAGCGGCTCTAAAGAAAACTGTACGACAGTTGGAGGCAAGACGAGATGATTTGTTGAAAAGGATTAAGGTACAAGAAGATAGAGGTCTAAACCTATTGGATGAAGTCCAACAATGGCTTTCTGAGGTCGAAAGTAGGGTATGTGAAGCCCATGATATCCTCTCGCAAAGCGATGAAGAAATAGATAATTTATGTTGTGGCCAATATTGTTCTAAGAGATGTAAATATAGCTACGACTATAGTAAAAGTGTAATCAACAAGTTGCAAGATGTTGAGAATCTTCTATCTAAAGGCGTTTTTGATGAAGTTGCTCAAAAAGGTCCTATACCAAAGGTGGAGGAAAGGCTTTTCCACCAGGAGATAGTTGGTCAAGAGGCAATTGTTGAATCAACATGGAATAGTATGATGGAAGTGGGAGTTGGGCTTTTGGGTATATATGGTATGGGGGGAGTAGGCAAGACCACCCTCCTCTCTCAAATCAACAACAAGTTCCGCACAGTAAGCAACGATTTTGACATTGCAATATGGGTTGTAGTGTCTAAAAACCCAACTGTTAAGAGGATTCAAGAAGACATTGGAAAAAGACTAGATCTCTACAACGAGGGATGGGAACAAAAAACAGAAAATGAGATAGCATCAACCATAAAGAGGTCTTTAGAGAATAAGAAGTATATGCTATTGTTGGATGATATGTGGACGAAGGTGGATTTAGCAAACATTGGAATTCCGGTTCCTAAAAGAAATGGAAGTAAAATAGCATTCACAAGTCGTTCTAATGAAGTTTGCGGGAAAATGGGGGTAGATAAGGAGATAGAGGTAACATGTTTGATGTGGGATGATGCCTGGGATTTGTTCACGAGGAACATGAAAGAGACATTGGAAAGTCATCCAAAGATTCCCGAAGTTGCAAAATCAATAGCAAGAAAGTGCAATGGCTTGCCACTTGCTCTCAATGTCATTGGCGAGACCATGGCTCGCAAGAAGTCCATCGAAGAGTGGCATGACGCTGTTGGTGTTTTCTCAGGTATAGAAGCGGATATTCTTTCCATTTTGAAATTTAGCTACGATGACTTAAAGTGTGAGAAGACCAAGTCCTGCTTCCTTTTTAGTGCCTTGTTTCCTGAAGACTATGAAATAGGAAAAGATGACTTGATAGAGTACTGGGTAGGCCAGGGTATTATACTTGGTTCTAAAGGTATAAATTATAAGGGTTATACAATCATCGGCACTCTCACTCGTGCATATTTACTGAAGGAGAGTGAAACCAAAGAAAAAGTAAAGATGCATGATGTGGTTCGCGAAATGGCTCTGTGGATATCATCAGGATGTGGTGACCAGAAACAAAAGAATGTTCTTGTTGTGGAAGCCAATGCTCAACTAAGAGACATTCCAAAGATTGAGGACCAGAAAGCTGTGAGGAGGATGTCCTTGATATACAATCAGATCGAAGAGGCATGCGAAAGTCTTCACTGTCCCAAGCTCGAAACCTTACTCCTTCGAGATAACAGATTAAGGAAGATCTCACGTGAATTTTTGTCGCATGTGCCGATCCTTATGGTATTAGATCTTTCTTTGAATCCAAACCTGATAGAGTTGCCCAGCTTTTCACCACTTTACTCTTTACGGTTTCTCAATCTGTCATGCACTGGGATAACGAGCCTTCCAGATGGGTTGTACGCACTGAGAAACCTGTTATACTTGAATTTGGAGCATACGTACATGCTGAAACGTATCTATGAGATACATGATTTACCGAATTTGGAAGTTCTGAAATTGTATGCTTCTGGAATAGATATAACTGACAAGCTAGTGAGGCAGATACAAGCCATGAAGCATTTATATCTGTTAACTATAACCTTGAGAAACTCCTCTGGTTTGGAAATTTTTCTTGGGGATACGAGGTTCAGCAGCTACACCGAAGGTTTAACTCTCGATGAGCAGTCATATTATCAGTCACTCAAAGTGCCACTTGCAACGATTTCGAGTAGTCGCTTCCTCGAAATTCAAGACTCGCATATACCGAAGATAGAGATAGAAGGGTCAAGCAGCAACGAGTCTGAGATAGTTGGACCGAGGGTTCGGAGGGACATATCCTTTATTAACCTCCGCAAAGTGAGATTAGATAACTGCACTGGTCTCAAGGACTTGACATGGCTGGTTTTTGCTCCACATCTAGCTACTCTATATGTGGTATGCTTACCCGATATAGAACACATTATAAGCAGATCTGAGGAATCTAGGTTGCAAAAAACTTGTGAGTTAGCAGGTGTCATTCCGTTTCGAGAACTGGAATTCCTTACTCTGAGGAATTTGGGGCAACTGAAGAGCATATACAGGGATCCTTTGCTTTTTGGGAAACTGAAGGAAATCAACATTAAAAGCTGTCCGAAGTTAACAAAACTTCCACTTGATTCTAGGAGCGCCTGGAAGCAAAATGTTGTCATAAATGCAGAAGAAGAATGGCTGCAAGGGCTTCAATGGGAAGATGTAGCGACTAAGGAGCGTTTTTTCCCAAGCTAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MGACFSVAISCDQAVNNLTSCLSRNQNRFRNLVDHVAALKKTVRQLEARRDDLLKRIKVQEDRGLNLLDEVQQWLSEVESRVCEAHDILSQSDEEIDNLCCGQYCSKRCKYSYDYSKSVINKLQDVENLLSKGVFDEVAQKGPIPKVEERLFHQEIVGQEAIVESTWNSMMEVGVGLLGIYGMGGVGKTTLLSQINNKFRTVSNDFDIAIWVVVSKNPTVKRIQEDIGKRLDLYNEGWEQKTENEIASTIKRSLENKKYMLLLDDMWTKVDLANIGIPVPKRNGSKIAFTSRSNEVCGKMGVDKEIEVTCLMWDDAWDLFTRNMKETLESHPKIPEVAKSIARKCNGLPLALNVIGETMARKKSIEEWHDAVGVFSGIEADILSILKFSYDDLKCEKTKSCFLFSALFPEDYEIGKDDLIEYWVGQGIILGSKGINYKGYTIIGTLTRAYLLKESETKEKVKMHDVVREMALWISSGCGDQKQKNVLVVEANAQLRDIPKIEDQKAVRRMSLIYNQIEEACESLHCPKLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSLRFLNLSCTGITSLPDGLYALRNLLYLNLEHTYMLKRIYEIHDLPNLEVLKLYASGIDITDKLVRQIQAMKHLYLLTITLRNSSGLEIFLGDTRFSSYTEGLTLDEQSYYQSLKVPLATISSSRFLEIQDSHIPKIEIEGSSSNESEIVGPRVRRDISFINLRKVRLDNCTGLKDLTWLVFAPHLATLYVVCLPDIEHIISRSEESRLQKTCELAGVIPFRELEFLTLRNLGQLKSIYRDPLLFGKLKEINIKSCPKLTKLPLDSRSAWKQNVVINAEEEWLQGLQWEDVATKERFFPS

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
137-369 SSF52540

EVAQKGPIPKVEERLFHQEIVGQEAIVESTWNSMMEVGVGLLGIYGMGGVGKTTLLSQINNKFRTVSNDFDIAIWVVVSKNPTVKRIQEDIGKRLDLYNEGWEQKTENEIASTIKRSLENKKYMLLLDDMWTKVDLANIGIPVPKRNGSKIAFTSRSNEVCGKMGVDKEIEVTCLMWDDAWDLFTRNMKETLESHPKIPEVAKSIARKCNGLPLALNVIGETMARKKSIEEWH

HMMPfam: PF00931
IPR002182
161-429 NB-ARC,NBS
NB-ARC

AIVESTWNSMMEVGVGLLGIYGMGGVGKTTLLSQINNKFRTVSNDFDIAIWVVVSKNPTVKRIQEDIGKRLDLYNEGWEQKTENEIASTIKRSLENKKYMLLLDDMWTKVDLANIGIPVPKRNGSKIAFTSRSNEVCGKMGVDKEIEVTCLMWDDAWDLFTRNMKETLESHPKIPEVAKSIARKCNGLPLALNVIGETMARKKSIEEWHDAVGVFSGIEADILSILKFSYDDLKCEKTKSCFLFSALFPEDYEIGKDDLIEYWVGQGII

Gene3D: G3DSA:3.40.50.300
176-267 G3DSA:3.40.50.300

GLLGIYGMGGVGKTTLLSQINNKFRTVSNDFDIAIWVVVSKNPTVKRIQEDIGKRLDLYNEGWEQKTENEIASTIKRSLENKKYMLLLDDMW

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

LLGIYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

SLENKKYMLLLDDMW

HMMPanther: PTHR10588
289-738 PTHR10588,LRR,FAMILY NOT NAMED

FTSRSNEVCGKMGVDKEIEVTCLMWDDAWDLFTRNMKETLESHPKIPEVAKSIARKCNGLPLALNVIGETMARKKSIEEWHDAVGVFSGIEADILSILKFSYDDLKCEKTKSCFLFSALFPEDYEIGKDDLIEYWVGQGIILGSKGINYKGYTIIGTLTRAYLLKESETKEKVKMHDVVREMALWISSGCGDQKQKNVLVVEANAQLRDIPKIEDQKAVRRMSLIYNQIEEACESLHCPKLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSLRFLNLSCTGITSLPDGLYALRNLLYLNLEHTYMLKRIYEIHDLPNLEVLKLYASGIDITDKLVRQIQAMKHLYLLTITLRNSSGLEIFLGDTRFSSYTEGLTLDEQSYYQSLKVPLATISSSRFLEIQDSHIPKIEIEGSSSNESEIVGPRVRRDISFINLR

HMMPanther: PTHR10588:SF60
289-738 PTHR10588:SF60,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

FTSRSNEVCGKMGVDKEIEVTCLMWDDAWDLFTRNMKETLESHPKIPEVAKSIARKCNGLPLALNVIGETMARKKSIEEWHDAVGVFSGIEADILSILKFSYDDLKCEKTKSCFLFSALFPEDYEIGKDDLIEYWVGQGIILGSKGINYKGYTIIGTLTRAYLLKESETKEKVKMHDVVREMALWISSGCGDQKQKNVLVVEANAQLRDIPKIEDQKAVRRMSLIYNQIEEACESLHCPKLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSLRFLNLSCTGITSLPDGLYALRNLLYLNLEHTYMLKRIYEIHDLPNLEVLKLYASGIDITDKLVRQIQAMKHLYLLTITLRNSSGLEIFLGDTRFSSYTEGLTLDEQSYYQSLKVPLATISSSRFLEIQDSHIPKIEIEGSSSNESEIVGPRVRRDISFINLR

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CNGLPLALNVIGETM

superfamily: SSF52058
446-873 SSF52058,LRR

LTRAYLLKESETKEKVKMHDVVREMALWISSGCGDQKQKNVLVVEANAQLRDIPKIEDQKAVRRMSLIYNQIEEACESLHCPKLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSLRFLNLSCTGITSLPDGLYALRNLLYLNLEHTYMLKRIYEIHDLPNLEVLKLYASGIDITDKLVRQIQAMKHLYLLTITLRNSSGLEIFLGDTRFSSYTEGLTLDEQSYYQSLKVPLATISSSRFLEIQDSHIPKIEIEGSSSNESEIVGPRVRRDISFINLRKVRLDNCTGLKDLTWLVFAPHLATLYVVCLPDIEHIISRSEESRLQKTCELAGVIPFRELEFLTLRNLGQLKSIYRDPLLFGKLKEINIKSCPKLTKLPLDSRSAWKQNVVINAEEEWLQGLQWEDVATKERFFP

Gene3D: G3DSA:3.80.10.10
489-632 G3DSA:3.80.10.10

VEANAQLRDIPKIEDQKAVRRMSLIYNQIEEACESLHCPKLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSLRFLNLSCTGITSLPDGLYALRNLLYLNLEHTYMLKRIYEIHDLPNLEVLKLYASGI

HMMPfam: PF13855
527-584 LRR_8,Leucine rich repeat

PKLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSLRFLNLSCT

FPrintScan: PR00364
IPR000767
548-564 DISEASERSIST
Disease resistance protein

SHVPILMVLDLSLNPNL

Gene3D: G3DSA:3.80.10.10
726-839 G3DSA:3.80.10.10

PRVRRDISFINLRKVRLDNCTGLKDLTWLVFAPHLATLYVVCLPDIEHIISRSEESRLQKTCELAGVIPFRELEFLTLRNLGQLKSIYRDPLLFGKLKEINIKSCPKLTKLPLD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox