PRGDB00046986 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18416507 (NM_121163)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G11250) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCGTTTTTCCTTACCACTGTTGCAGCTGCAATAGGCTTCTTCACCCTTTTGAGAAAACTCAGATTCCATCATGATAACAAAGAAAAGAAGTCAACTTCTTTATCTCCTTCATCATCTCCATCTTCTTTGTCTCCTTCATCAGTTCCTCCACCTTCTTCGTCTTGCATCTGGACACACCAAGTCTTTCCCAGCTTCAGCGGGGAAGATGTCCGTAGAGACTTTCTCAGTCACATTCAGATGGAGTTTCAAAGAATGGGAATCACTCCATTCGTTGATAATGAGATTAAAAGAGGAGAATCCATCGGTCCTGAGCTTCTGCGGGCTATTAGAGGGTCTAAGATAGCAATTATCTTGCTCTCTAGGAACTATGCTTCTTCAAAATGGTGTCTTGACGAACTGGTGGAGATTATGAAATGCAGAGAAGAGTATGGTCAAACTGTGATGGCCATATTTTACAAAGTGGATCCTTCTGATGTAAAAAATCTGACCGGAGATTTCGGGAAAGTCTTTAGAAAAACTTGTGCCGGTAAACCAAAGAAGGACATTGGGAGATGGAGACAAGCTTGGGAAAAAGTGGCCACAGTAGCTGGTTACCATTCAATCAACTGGGATAATGAAGCGGCCATGATCAAGAAAATCGCCACTGATATTTCGAACATATTGATTAATTCCACTCCTTCACGTGATTTCGACGGGTTAGTTGGGATGAGAGCTCATTTAGAAAAGATGAAACCGTTGTTATGCCTAGACACAGACGAAGTAAGGATAATTGGGATTTGGGGTCCTCCTGGGATTGGGAAGACCACAATTGCCAGAGTTGTATACAACCAACTCTCCCACAGTTTCCAACTGAGTGTCTTTATGGAGAATATCAAAGCAAACTATACCAGACCAACTGGCTCCGATGACTACAGTGCAAAGTTGCAATTACAACAAATGTTTATGTCTCAAATAACCAAGCAAAAGGATATAGAGATTCCTCATTTAGGAGTTGCCCAAGATAGGTTGAAAGACAAGAAAGTTCTGGTCGTTCTTGATGGGGTGAACCAGTCAGTACAACTAGATGCGATGGCGAAAGAAGCTTGGTGGTTTGGTCCTGGGAGTCGAATCATCATTACAACACAAGATCAGAAACTTTTTAGAGCACATGGGATTAACCATATTTACAAGGTGGATTTTCCACCAACTGAAGAGGCTCTTCAAATCTTCTGCATGTATGCTTTTGGTCAAAATTCCCCTAAAGATGGTTTTCAGAACCTTGCTTGGAAAGTAATAAATCTTGCCGGTAACCTCCCTTTGGGGCTAAGAATTATGGGCTCCTATTTTAGGGGAATGTCGAGAGAAGAGTGGAAAAAGTCATTACCAAGATTAGAGAGTAGCCTTGACGCTGATATTCAAAGCATTTTGAAGTTCAGCTATGACGCTTTAGATGACGAAGATAAAAATTTATTTCTTCATATAGCATGTTTTTTCAACGGTAAAGAGATTAAGATATTGGAAGAGCATCTTGCAAAGAAGTTTGTGGAAGTCAGGCAAAGACTTAACGTCTTAGCTGAGAAATCTCTCATATCTTTTAGCAATTGGGGAACTATAGAGATGCATAAACTGCTAGCAAAACTAGGTGGAGAAATTGTTCGTAACCAATCTATCCATGAGCCTGGACAACGCCAGTTTTTGTTTGATGGAGAAGAGATATGTGATGTGCTGAATGGTGATGCAGCAGGTAGTAAAAGTGTAATAGGCATAGATTTCCACTACATAATCGAGGAAGAATTCGATATGAATGAGAGAGTTTTTGAAGGAATGTCTAATCTTCAGTTCTTAAGATTCGATTGTGACCATGATACATTGCAATTATCCCGCGGTCTGAGCTATCTTTCTCGTAAACTTCAGTTACTAGATTGGATATATTTTCCGATGACATGTTTGCCTTCTACTGTGAACGTGGAGTTCCTTATTGAACTAAACCTGACGCACAGCAAGCTTGATATGTTGTGGGAAGGAGTTAAACCGCTTCATAATCTCAGGCAGATGGATTTGAGTTATTCTGTAAACTTGAAGGAGCTTCCTGATCTCTCAACTGCCATTAATCTCCGAAAGTTGATTCTTTCTAATTGCTCCAGTCTGATCAAACTCCCTTCTTGTATTGGGAATGCCATCAATCTCGAGGATTTAGATCTTAATGGATGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGGATGCCATTAACCTTCAAAAATTGCTTCTTCGCTATTGCTCAAATCTGGTGGAGCTCCCCTCTTCTATTGGGAATGCCATTAATCTTCGGGAATTGGATCTTTATTATTGCTCGAGTCTGATCAGACTTCCCTCCTCTATTGGGAATGCCATTAATCTTTTGATTTTAGATCTTAACGGATGCTCAAATCTATTGGAGCTCCCATCCTCCATTGGGAATGCCATTAATCTCCAAAAACTGGATCTTCGCAGATGCGCAAAGCTATTAGAGCTCCCGTCTTCTATTGGGAATGCCATTAATCTCCAAAACCTGCTTCTTGACGATTGCTCAAGTCTGTTGGAGCTCCCCTCGTCTATTGGGAATGCCACTAATTTAGTGTACATGAACCTTAGTAATTGCTCAAATCTGGTGGAGCTTCCTCTTTCTATAGGAAACCTTCAGAAGTTGCAGGAATTGATTTTAAAAGGATGCTCTAAGCTAGAGGATCTTCCCATCAACATCAACTTGGAATCTTTGGACATACTTGTGCTCAATGATTGCTCCATGTTGAAAAGGTTTCCTGAGATCTCTACTAACGTTAGAGCTCTCTATCTCTGTGGAACCGCAATAGAAGAAGTGCCTCTCTCGATCAGGTCATGGCCCCGTCTTGATGAATTGCTGATGTCATACTTTGATAATCTAGTGGAATTCCCTCATGTTCTTGACATCATCACAAATCTGGACTTGAGCGGTAAAGAAATACAAGAGGTTCCTCCACTGATCAAGAGAATATCTCGTCTTCAGACACTCATACTCAAGGGGTACAGAAAGGTGGTATCACTCCCACAGATTCCAGATTCTTTAAAATGGATTGATGCTGAAGATTGTGAGTCCTTGGAGAGACTAGATTGCTCCTTTCACAATCCAGAGATTACTCTCTTCTTTGGTAAGTGCTTTAAACTTAATCAAGAAGCAAGAGACCTAATCATCCAGACACCGACTAAACAAGCAGTCTTACCTGGTAGAGAGGTGCCTGCATACTTCACTCACCGAGCGAGTGGGGGTTCATTGACAATTAAGTTGAATGAGAGGCCTCTTCCTACATCTATGAGATATAAGGCTTGCATCTTGCTAGTTCGTATTGGTGACTATGGCGCTCATGATAGAGACAAATGGTTACATGTTGCTTTCGGTGTTAGGTCTACAACATTGGGGCACATTATATATTCAGGCTTAACAGAGCATCTGTACACATTCGAAATCGAAGAGAAGGTGACTTCCAGCGAGCTTGTCTTTGAGTTCAAGGTCGAGAACGGTAACCACTGGAAGATTGGAGAATGCGGGTTACGCCAACTATCGTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSFFLTTVAAAIGFFTLLRKLRFHHDNKEKKSTSLSPSSSPSSLSPSSVPPPSSSCIWTHQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLNGDAAGSKSVIGIDFHYIIEEEFDMNERVFEGMSNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREVPAYFTHRASGGSLTIKLNERPLPTSMRYKACILLVRIGDYGAHDRDKWLHVAFGVRSTTLGHIIYSGLTEHLYTFEIEEKVTSSELVFEFKVENGNHWKIGECGLRQLS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
60-198 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WTHQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATV

Gene3D: G3DSA:3.40.50.10140
60-197 G3DSA:3.40.50.10140

WTHQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVAT

HMMSmart: SM00255
IPR000157
61-198 TIR
Toll/interleukin-1 receptor homology (TIR) domain

THQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATV

HMMPfam: PF01582
IPR000157
64-191 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNEIKRGESIGPELLRAIRGSKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQA

superfamily: SSF52540
115-488 SSF52540

SKIAIILLSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFL

HMMPanther: PTHR23155:SF292
122-1080 PTHR23155:SF292,SUBFAMILY NOT NAMED

LSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLNGDAAGSKSVIGIDFHYIIEEEFDMNERVFEGMSNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

HMMPanther: PTHR23155
122-1080 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSRNYASSKWCLDELVEIMKCREEYGQTVMAIFYKVDPSDVKNLTGDFGKVFRKTCAGKPKKDIGRWRQAWEKVATVAGYHSINWDNEAAMIKKIATDISNILINSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLNGDAAGSKSVIGIDFHYIIEEEFDMNERVFEGMSNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

Gene3D: G3DSA:3.40.50.300
225-269 G3DSA:3.40.50.300

INSTPSRDFDGLVGMRAHLEKMKPLLCLDTDEVRIIGIWGPPGIG

HMMPfam: PF00931
IPR002182
241-501 NB-ARC,NBS
NB-ARC

AHLEKMKPLLCLDTDEVRIIGIWGPPGIGKTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYSAKLQLQQMFMSQITKQKDIEIPHLGVAQDRLKDKKVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIFCMYAFGQNSPKDGFQNLAWKVINLAGNLPLGLRIMGSYFRGMSREEWKKSLPRLESSLDADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKI

FPrintScan: PR00364
IPR000767
259-274 DISEASERSIST
Disease resistance protein

IIGIWGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
270-308 G3DSA:3.40.50.300

KTTIARVVYNQLSHSFQLSVFMENIKANYTRPTGSDDYS

FPrintScan: PR00364
IPR000767
338-352 DISEASERSIST
Disease resistance protein

RLKDKKVLVVLDGVN

Gene3D: G3DSA:3.40.50.300
343-406 G3DSA:3.40.50.300

KVLVVLDGVNQSVQLDAMAKEAWWFGPGSRIIITTQDQKLFRAHGINHIYKVDFPPTEEALQIF

FPrintScan: PR00364
IPR000767
431-445 DISEASERSIST
Disease resistance protein

AGNLPLGLRIMGSYF

superfamily: SSF46785
466-573 SSF46785

ADIQSILKFSYDALDDEDKNLFLHIACFFNGKEIKILEEHLAKKFVEVRQRLNVLAEKSLISFSNWGTIEMHKLLAKLGGEIVRNQSIHEPGQRQFLFDGEEICDVLN

superfamily: SSF52058
606-907 SSF52058,LRR

SNLQFLRFDCDHDTLQLSRGLSYLSRKLQLLDWIYFPMTCLPSTVNVEFLIELNLTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLP

HMMPfam: PF07725
IPR011713
654-673 LRR_3
Leucine-rich repeat 3

FLIELNLTHSKLDMLWEGVK

Gene3D: G3DSA:3.80.10.10
660-868 G3DSA:3.80.10.10

LTHSKLDMLWEGVKPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNL

HMMPfam: PF00560
IPR001611
724-743 LRR_1
Leucine-rich repeat

NLEDLDLNGCSSLVELPSFG

HMMPfam: PF00560
IPR001611
819-840 LRR_1
Leucine-rich repeat

NLQKLDLRRCAKLLELPSSIGN

superfamily: SSF52058
843-1057 SSF52058,LRR

NLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKL

HMMPfam: PF00560
IPR001611
867-889 LRR_1
Leucine-rich repeat

NLVYMNLSNCSNLVELPLSIGNL

Gene3D: G3DSA:3.80.10.10
869-1041 G3DSA:3.80.10.10

VYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCS

FPrintScan: PR00364
IPR000767
887-903 DISEASERSIST
Disease resistance protein

GNLQKLQELILKGCSKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox