PRGDB00046987 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18418595 (NM_121842)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G18370) mRNA, complete cds.

DNA Sequence

ATGGCTATTGCAGAGGTGATTGGTTTCTTCACACTTGTTTGTGTAATTTGGTATTGGGTTTACAAAAAGCACAAGAATTTGCAGCTGAAGATATGCAGATCATCAATCGAGTCTTCTTCTTCTTCGTCGTCCCTTTCATCTCCTCCATCTCTTTCGTCTCCTATATCTCGAACCTGGACACACCAAGTCTTTCCGAGCTTCCGCGGGGAAGACGTACGGAAAGGGTTTCTTAGTCATATCCAGAAGGAGTTCAAAAGCAAAGGAATCGTTCCCTTTATTGATGACGAAATGAAGAGAGGCGAATCGATCGGTCCGGGGCTGTTTCAGGCCATTAGAGAATCAAAGATAGCAATTGTCTTGCTCTCAAAGAACTACGCTTCGTCTAGCTGGTGCCTCAACGAATTGGTGGAGATTATGAATTGCAGGGAAGAGATTGGTCAAACGGTGATGACTGTTTTCTATCAAGTGGATCCATCTGATGTGAGAAAACAGACCGGAGATTTCGGTAAAGCCTTTAAGAAAACCTGTGTTGGCAAAACACAAGAGGTGAAGCAGAGATGGAGTCGAGCTTTGATGGACGTCGCAAACATACTCGGACAAGATTCTCGCAAATGGGATAAAGAAGCGGACATGATTGTGAAAGTTGCAAAAGATGTATCAGACGTCTTGAGCTATACGCCGTCGAGGGATTTTGATGACTATGTTGGAATCCGTCCTCATATCACAAGAATCAATTCCTTGTTATGCCTAGAGTCTAGTGATGTGAGGATGATAGGGATATTGGGTCCTCCTGGGATTGGCAAGACCACCATTGCACGAGTTTTATATGATCAAATCTCTGAAAAGTTCCAGTTTTCTGCCTTTATAGAGAACATCAGACTAAGCTACTGGAAAGGCTGGCACGATGAGGGTAATTTGGATTTTCCAGTTGAGATCATGACTGGAGACCGGCAAAGGAAGTTGAATTTACAAAGACGGCTTTTGTCTGAGTTATTCAACCAGAAGGATATCCAGGTTCGTCATTTAGGTGCAGTTCAGGAGAGGCTCAGGGACCACAAAGTTCTTGTCATTCTTGATGGCGTCGATCAATTAGAGCAGCTAACTGCATTGGCGAAAGAAACTCAGTGGTTCGGCTATGGAAGTAGGATTATCATCACAACACAAGATCAAAGGCTTTTGAGAGCGCATGAGATCAACCATGTTTACAAGGTGGACCTCCCTGCTACAGATGAAGCTCTCCAGATCTTCTGTCTGTATGCTTTTGGTCAAAAGTTCCCATATGATGGTTTTAAGAAACTTGCTCGGGAGTTTACTGCACTTGCAGGTGAACTTCCTCTAGGTCTAAGAGTTTTGGGATCTTATTTGCGAGGAATGTCCTTGGAGGAGTGGAAAAACGCACTACCACGGTTAAGGACTAGCCTTGACGGTGAAATTGAGAAAACTCTAAGATTTGCCTACAATGTCTTGAGCGATAAAGATAAATCTCTTTTTCTCCATATAGCATGTTTGTTCAACGGCTGTCAAGTTAATCATGTGAAACAGTGGCTTGCTAACAGCAGTTTGGACGTTAACCATGGCTTTGAAGTCTTGAGCAATAAGTCTCTCATATCTACAGATATGGGACTCGTACGGATGCATTCTTTGCTTCAACAACTAGGTGTTGACATTGTCCGTAAACAATCTATTGGAGAGCCTGAAAAACGTCAGTTTTTAGTTGACGTTAATGAGATTTCTGATGTTATCACCGACAATACAGGCACTGGGACTATTCTAGGCATAATGCTTCATGTCTCTAAGATCGAGGATGTATTAGTTATAGAAGAAACGGTGTTTGATAGGATGACTAATCTCCAGTTTTTAATATTGGACGAGTGTTTGAGGGATAAGTTGAACTTACCACTAGGCCTGAATTGTCTACCCCGTAAAATCAGGTTATTGCGTTGGGACTATTGTCCGTTGAGCATTTGGCCCTCTAAGTTCTCTGCAAAGTTTCTCGTTGAGCTTATCATGCGGGCGAACAAATTTGAAAAACTGTGGGAAGGAATTCAGCCACTTAAAAATCTCAAAAGGATGGAGCTGGGTGACGCCAGGAACCTGAAAGAGATTCCAGATCTCTCAAATGCCACTAACCTCGAGTCATTGCTTCTCTCTTTTTGCACTAGTCTGTTGGAAATTCCTTCCTCTATTAGAGGCACCACTAATCTCAAGGAATTGGATCTCGGTGGTTGCGCAAGTCTGGTGAAGCTCTCTTCCTGTATTTGTAATGCCACTAGTCTCGAAGAATTGAATCTTAGTGCTTGCTCAAATTTGGTGGAGCTCCCCTGTGCTCTTCCTGGCGACAGCAATATGAGATCTCTGTCTAAACTTCTTTTGAACGGAAGCTCACGGTTGAAAACTTTTCCAGAGATCTCCACAAACATCCAAGAACTCAATCTGAGTGGTACAGCGATAGAAGAAGTGCCTTCATCGATCAGGTTGTGGTCTCGTCTCGATAAATTAGATATGTCGCGGTGCAAAAACCTGAAGATGTTTCCACCTGTTCCTGATGGAATTTCAGTGCTAAACTTGAGTGAGACAGAAATAGAAGACATTCCTCCGTGGGTCGAGAATCTCTCTCAGCTTCGACACTTCGTTATGATCAGATGCAAGAAGCTGGACAACATCTCATTATCAAGAATTTCCAAGATGGAAGGTGTTCATTGTCTGCAAATTACTCGTGGTGATGAGGATGTCTCTGGTGATTCGATAGTAAACATCAGGTGGTACTCTAACTTCCCAAACCAATGGACTTTACAGTCGGATATGTTACAAATTTGTCTGCCAGAGTTGGTTTATACTTCCCCAGTGTCCCTACACTTCATCAGTAATGAATTCAAGACTATTCCAGATTGCATCAAAAATCTTTCTCAACTACATCAGCTTTCGTTCTATAGATGCCATAAGCTTGTATCGCTGCCGCAACTTTCAGACTGCCTCTCATCTCTAGATGCAGAAAATTGTGTGTCACTTGAGACAATAGATGGCTCCTTTCACAATCCAGATATCCGTCTGAATTTTTTAAACTGCAACAACTTGAATCAAGAAGCAAGAGAACTCATCCAGAAATCGGTTTGCAAACATGCTCTGTTACCTTCTGGAGAAGTTCCTGCATACTTCATTCATCGAGCTATTGGAGATTCCGTAACAATTCATTTGAAAGAGAGGCATCTTCCTCTATATTTGATATTTAAGGCTTCTCTAGTGCTGTTCAATGACGATGAAATCAATTACGATTACGATGATGACGATGATGATGACTATGACGAGGAGGTCATAGTCTATGGTGATTATGATAGTTACCCTCATAGCGATGATTATACCAAACAGGAGACCATGAGGTTATCTTGTCGTGTCGAAGGCAAACAGAATGGCCTCACTATTCAGTATGGATCTAGTGTGCACCTTCTACCAACTCCGCATAGGTATACAGAGCATGTGTATATATTTGAAGCTTCTTTCTCCCTAGGCGAGTGCAACAGTCCTGAAGCAGAAAGCGAGCTTGTCTTTGACTTCAAGGTTCACGATTACTTTTGGGCGATAAAAGAGTGTGGTCTTCGACTCTTGGAGCTCCCTCATGCTCATGGAGACGATTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MAIAEVIGFFTLVCVIWYWVYKKHKNLQLKICRSSIESSSSSSSLSSPPSLSSPISRTWTHQVFPSFRGEDVRKGFLSHIQKEFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANILGQDSRKWDKEADMIVKVAKDVSDVLSYTPSRDFDDYVGIRPHITRINSLLCLESSDVRMIGILGPPGIGKTTIARVLYDQISEKFQFSAFIENIRLSYWKGWHDEGNLDFPVEIMTGDRQRKLNLQRRLLSELFNQKDIQVRHLGAVQERLRDHKVLVILDGVDQLEQLTALAKETQWFGYGSRIIITTQDQRLLRAHEINHVYKVDLPATDEALQIFCLYAFGQKFPYDGFKKLAREFTALAGELPLGLRVLGSYLRGMSLEEWKNALPRLRTSLDGEIEKTLRFAYNVLSDKDKSLFLHIACLFNGCQVNHVKQWLANSSLDVNHGFEVLSNKSLISTDMGLVRMHSLLQQLGVDIVRKQSIGEPEKRQFLVDVNEISDVITDNTGTGTILGIMLHVSKIEDVLVIEETVFDRMTNLQFLILDECLRDKLNLPLGLNCLPRKIRLLRWDYCPLSIWPSKFSAKFLVELIMRANKFEKLWEGIQPLKNLKRMELGDARNLKEIPDLSNATNLESLLLSFCTSLLEIPSSIRGTTNLKELDLGGCASLVKLSSCICNATSLEELNLSACSNLVELPCALPGDSNMRSLSKLLLNGSSRLKTFPEISTNIQELNLSGTAIEEVPSSIRLWSRLDKLDMSRCKNLKMFPPVPDGISVLNLSETEIEDIPPWVENLSQLRHFVMIRCKKLDNISLSRISKMEGVHCLQITRGDEDVSGDSIVNIRWYSNFPNQWTLQSDMLQICLPELVYTSPVSLHFISNEFKTIPDCIKNLSQLHQLSFYRCHKLVSLPQLSDCLSSLDAENCVSLETIDGSFHNPDIRLNFLNCNNLNQEARELIQKSVCKHALLPSGEVPAYFIHRAIGDSVTIHLKERHLPLYLIFKASLVLFNDDEINYDYDDDDDDDYDEEVIVYGDYDSYPHSDDYTKQETMRLSCRVEGKQNGLTIQYGSSVHLLPTPHRYTEHVYIFEASFSLGECNSPEAESELVFDFKVHDYFWAIKECGLRLLELPHAHGDD

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
49-200 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PSLSSPISRTWTHQVFPSFRGEDVRKGFLSHIQKEFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANILGQ

Gene3D: G3DSA:3.40.50.10140
57-198 G3DSA:3.40.50.10140

RTWTHQVFPSFRGEDVRKGFLSHIQKEFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANIL

ProfileScan: PS50104
IPR000157
59-197 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WTHQVFPSFRGEDVRKGFLSHIQKEFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANI

HMMSmart: SM00255
IPR000157
60-197 TIR
Toll/interleukin-1 receptor homology (TIR) domain

THQVFPSFRGEDVRKGFLSHIQKEFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANI

HMMPfam: PF01582
IPR000157
63-191 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFRGEDVRKGFLSHIQKEFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRAL

HMMPanther: PTHR11017
83-1202 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANILGQDSRKWDKEADMIVKVAKDVSDVLSYTPSRDFDDYVGIRPHITRINSLLCLESSDVRMIGILGPPGIGKTTIARVLYDQISEKFQFSAFIENIRLSYWKGWHDEGNLDFPVEIMTGDRQRKLNLQRRLLSELFNQKDIQVRHLGAVQERLRDHKVLVILDGVDQLEQLTALAKETQWFGYGSRIIITTQDQRLLRAHEINHVYKVDLPATDEALQIFCLYAFGQKFPYDGFKKLAREFTALAGELPLGLRVLGSYLRGMSLEEWKNALPRLRTSLDGEIEKTLRFAYNVLSDKDKSLFLHIACLFNGCQVNHVKQWLANSSLDVNHGFEVLSNKSLISTDMGLVRMHSLLQQLGVDIVRKQSIGEPEKRQFLVDVNEISDVITDNTGTGTILGIMLHVSKIEDVLVIEETVFDRMTNLQFLILDECLRDKLNLPLGLNCLPRKIRLLRWDYCPLSIWPSKFSAKFLVELIMRANKFEKLWEGIQPLKNLKRMELGDARNLKEIPDLSNATNLESLLLSFCTSLLEIPSSIRGTTNLKELDLGGCASLVKLSSCICNATSLEELNLSACSNLVELPCALPGDSNMRSLSKLLLNGSSRLKTFPEISTNIQELNLSGTAIEEVPSSIRLWSRLDKLDMSRCKNLKMFPPVPDGISVLNLSETEIEDIPPWVENLSQLRHFVMIRCKKLDNISLSRISKMEGVHCLQITRGDEDVSGDSIVNIRWYSNFPNQWTLQSDMLQICLPELVYTSPVSLHFISNEFKTIPDCIKNLSQLHQLSFYRCHKLVSLPQLSDCLSSLDAENCVSLETIDGSFHNPDIRLNFLNCNNLNQEARELIQKSVCKHALLPSGEVPAYFIHRAIGDSVTIHLKERHLPLYLIFKASLVLFNDDEINYDYDDDDDDDYDEEVIVYGDYDSYPHSDDYTKQETMRLSCRVEGKQNGLTIQYGSSVHLLPTPHRYTEHVYIFEASFSLGECNSPEAESELVFDFKVHDYFWAIKECGLRLLE

HMMPanther: PTHR11017:SF20
83-1202 PTHR11017:SF20,SUBFAMILY NOT NAMED

EFKSKGIVPFIDDEMKRGESIGPGLFQAIRESKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANILGQDSRKWDKEADMIVKVAKDVSDVLSYTPSRDFDDYVGIRPHITRINSLLCLESSDVRMIGILGPPGIGKTTIARVLYDQISEKFQFSAFIENIRLSYWKGWHDEGNLDFPVEIMTGDRQRKLNLQRRLLSELFNQKDIQVRHLGAVQERLRDHKVLVILDGVDQLEQLTALAKETQWFGYGSRIIITTQDQRLLRAHEINHVYKVDLPATDEALQIFCLYAFGQKFPYDGFKKLAREFTALAGELPLGLRVLGSYLRGMSLEEWKNALPRLRTSLDGEIEKTLRFAYNVLSDKDKSLFLHIACLFNGCQVNHVKQWLANSSLDVNHGFEVLSNKSLISTDMGLVRMHSLLQQLGVDIVRKQSIGEPEKRQFLVDVNEISDVITDNTGTGTILGIMLHVSKIEDVLVIEETVFDRMTNLQFLILDECLRDKLNLPLGLNCLPRKIRLLRWDYCPLSIWPSKFSAKFLVELIMRANKFEKLWEGIQPLKNLKRMELGDARNLKEIPDLSNATNLESLLLSFCTSLLEIPSSIRGTTNLKELDLGGCASLVKLSSCICNATSLEELNLSACSNLVELPCALPGDSNMRSLSKLLLNGSSRLKTFPEISTNIQELNLSGTAIEEVPSSIRLWSRLDKLDMSRCKNLKMFPPVPDGISVLNLSETEIEDIPPWVENLSQLRHFVMIRCKKLDNISLSRISKMEGVHCLQITRGDEDVSGDSIVNIRWYSNFPNQWTLQSDMLQICLPELVYTSPVSLHFISNEFKTIPDCIKNLSQLHQLSFYRCHKLVSLPQLSDCLSSLDAENCVSLETIDGSFHNPDIRLNFLNCNNLNQEARELIQKSVCKHALLPSGEVPAYFIHRAIGDSVTIHLKERHLPLYLIFKASLVLFNDDEINYDYDDDDDDDYDEEVIVYGDYDSYPHSDDYTKQETMRLSCRVEGKQNGLTIQYGSSVHLLPTPHRYTEHVYIFEASFSLGECNSPEAESELVFDFKVHDYFWAIKECGLRLLE

superfamily: SSF52540
114-498 SSF52540

SKIAIVLLSKNYASSSWCLNELVEIMNCREEIGQTVMTVFYQVDPSDVRKQTGDFGKAFKKTCVGKTQEVKQRWSRALMDVANILGQDSRKWDKEADMIVKVAKDVSDVLSYTPSRDFDDYVGIRPHITRINSLLCLESSDVRMIGILGPPGIGKTTIARVLYDQISEKFQFSAFIENIRLSYWKGWHDEGNLDFPVEIMTGDRQRKLNLQRRLLSELFNQKDIQVRHLGAVQERLRDHKVLVILDGVDQLEQLTALAKETQWFGYGSRIIITTQDQRLLRAHEINHVYKVDLPATDEALQIFCLYAFGQKFPYDGFKKLAREFTALAGELPLGLRVLGSYLRGMSLEEWKNALPRLRTSLDGEIEKTLRFAYNVLSDKDKSLFL

Gene3D: G3DSA:3.40.50.300
229-267 G3DSA:3.40.50.300

RDFDDYVGIRPHITRINSLLCLESSDVRMIGILGPPGIG

HMMPfam: PF00931
IPR002182
240-516 NB-ARC,NBS
NB-ARC

HITRINSLLCLESSDVRMIGILGPPGIGKTTIARVLYDQISEKFQFSAFIENIRLSYWKGWHDEGNLDFPVEIMTGDRQRKLNLQRRLLSELFNQKDIQVRHLGAVQERLRDHKVLVILDGVDQLEQLTALAKETQWFGYGSRIIITTQDQRLLRAHEINHVYKVDLPATDEALQIFCLYAFGQKFPYDGFKKLAREFTALAGELPLGLRVLGSYLRGMSLEEWKNALPRLRTSLDGEIEKTLRFAYNVLSDKDKSLFLHIACLFNGCQVNHVKQWL

HMMSmart: SM00382
IPR003593
254-405 AAA,NBS
AAA+ ATPase domain

DVRMIGILGPPGIGKTTIARVLYDQISEKFQFSAFIENIRLSYWKGWHDEGNLDFPVEIMTGDRQRKLNLQRRLLSELFNQKDIQVRHLGAVQERLRDHKVLVILDGVDQLEQLTALAKETQWFGYGSRIIITTQDQRLLRAHEINHVYKVD

FPrintScan: PR00364
IPR000767
257-272 DISEASERSIST
Disease resistance protein

MIGILGPPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
268-416 G3DSA:3.40.50.300

KTTIARVLYDQISEKFQFSAFIENIRLSYWKGWHDEGNLDFPVEIMTGDRQRKLNLQRRLLSELFNQKDIQVRHLGAVQERLRDHKVLVILDGVDQLEQLTALAKETQWFGYGSRIIITTQDQRLLRAHEINHVYKVDLPATDEALQIF

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

RLRDHKVLVILDGVD

FPrintScan: PR00364
IPR000767
441-455 DISEASERSIST
Disease resistance protein

AGELPLGLRVLGSYL

superfamily: SSF52058
544-1027 SSF52058,LRR

RMHSLLQQLGVDIVRKQSIGEPEKRQFLVDVNEISDVITDNTGTGTILGIMLHVSKIEDVLVIEETVFDRMTNLQFLILDECLRDKLNLPLGLNCLPRKIRLLRWDYCPLSIWPSKFSAKFLVELIMRANKFEKLWEGIQPLKNLKRMELGDARNLKEIPDLSNATNLESLLLSFCTSLLEIPSSIRGTTNLKELDLGGCASLVKLSSCICNATSLEELNLSACSNLVELPCALPGDSNMRSLSKLLLNGSSRLKTFPEISTNIQELNLSGTAIEEVPSSIRLWSRLDKLDMSRCKNLKMFPPVPDGISVLNLSETEIEDIPPWVENLSQLRHFVMIRCKKLDNISLSRISKMEGVHCLQITRGDEDVSGDSIVNIRWYSNFPNQWTLQSDMLQICLPELVYTSPVSLHFISNEFKTIPDCIKNLSQLHQLSFYRCHKLVSLPQLSDCLSSLDAENCVSLETIDGSFHNPDIRLNFLNCNNLNQ

Gene3D: G3DSA:3.80.10.10
606-886 G3DSA:3.80.10.10

IEETVFDRMTNLQFLILDECLRDKLNLPLGLNCLPRKIRLLRWDYCPLSIWPSKFSAKFLVELIMRANKFEKLWEGIQPLKNLKRMELGDARNLKEIPDLSNATNLESLLLSFCTSLLEIPSSIRGTTNLKELDLGGCASLVKLSSCICNATSLEELNLSACSNLVELPCALPGDSNMRSLSKLLLNGSSRLKTFPEISTNIQELNLSGTAIEEVPSSIRLWSRLDKLDMSRCKNLKMFPPVPDGISVLNLSETEIEDIPPWVENLSQLRHFVMIRCKKLD

HMMPfam: PF07725
IPR011713
664-683 LRR_3
Leucine-rich repeat 3

FLVELIMRANKFEKLWEGIQ

FPrintScan: PR00364
IPR000767
730-746 DISEASERSIST
Disease resistance protein

RGTTNLKELDLGGCASL

HMMPfam: PF00560
IPR001611
758-776 LRR_1
Leucine-rich repeat

SLEELNLSACSNLVELPCA

Gene3D: G3DSA:3.80.10.10
939-1002 G3DSA:3.80.10.10

CLPELVYTSPVSLHFISNEFKTIPDCIKNLSQLHQLSFYRCHKLVSLPQLSDCLSSLDAENCVS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox