PRGDB00046988 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18418593 (NM_121841)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G18360) mRNA, complete cds.

DNA Sequence

ATGGAAGAATCTTCATCTTTGTCATTGCAGTCTTGCAATTGGAGACACCATGTGTTTCCAAGCTTCAGCGGCAAAGATGTCCGCAGAACCTTTCTCAGCCACCTTCTCAAGGAGTTCCGGCGTAAGGGAATCCGTACTTTCATAGATAATGATATCAAGAGAAGCCAAATGATCAGTTCTGAGCTTGTACGAGCTATCAGAGAATCTAGGATTGCGGTTGTAGTGTTGTCGCGGACCTATGCATCTTCAAGCTGGTGTTTGAATGAGTTGGTGGAGATAAAGAAAGTAAGCCAGATGATCATGCCGGTTTTCTACGAGGTGGATCCATCTGATGTGAGGAAACGAACGGGAGAATTTGGAAAGGCGTTTGAGGAAGCATGTGAAAGACAACCAGATGAGGAAGTGAAGCAGAAATGGAGAGAAGCATTGGTCTATATAGCTAATATAGCCGGCGAGTCTTCTCAAAACTGGGACAATGAAGCAGATCTGATTGACAAGATTGCTATGAGCATTTCATATGAATTGAATTCTACATTATCACGAGATTCCTACAATCTGGTTGGAATCGACAATCATATGAGAGAGCTGGATTCTTTGTTATGTCTGGAATCAACTGAAGTGAAAATGGTGGGGATTTGGGGTCCTGCAGGTATTGGCAAGACAACAATTGCCAGAGCTTTATTCAACCGGCTATCTGAAAACTTCCAACACACTATTTTTATGGAGAATGTTAAGGGAAGTTCTAGGACCTCGGAGCTCGATGCCTATGGCTTCCAGTTGCGTTTGCAAGAACAGTTTCTGTCTGAAGTTATTGATCATAAGCATATGAAGATACATGATTTAGGTTTGGTAAAAGAAAGATTGCAGGATCTGAAAGTTCTTGTTGTTCTTGATGATGTTGATAAACTAGAACAACTTGATGCCTTAGTGAAACAATCTCAGTGGTTTGGTTCTGGAAGTAGGATCATTGTGACCACGGAAAACAAACAGCTATTGAGAGCGCATGGGATCACTTGCATATATGAGTTGGGTTTTCCATCTAGAAGTGATTCTCTTCAGATTTTCTGCCAATATGCATTTGGAGAGAGTTCTGCACCAGATGGTTGTATCGAGCTTGCTACTGAAATAACAAAGCTTGCTGGCTATCTTCCCCTAGCTCTAAAGGTTTTGGGGTCCTCTCTGCGAGGGATGAGCAAAGATGAGCAAAAATCAGCATTGCCTCGACTCAGAACCAGTCTTAATGAGGATATTAGAAATGTTTTACGAGTCGGTTATGATGGTATACATGACAAGGATAAGGTCATATTCCTTCATATTGCTTGTTTATTCAATGGTGAGAACGTTGATTATGTGAAGCAAATACTTGCAAGTTCTGGCTTGGATGTCACATTTGGGCTTCAAGTCCTTACCAGTAGGTCTCTCATACACATATCGAGATGCAATCGTACTATTACGATGCACAATTTGCTAGAACAATTGGGTCGAGAAATTGTTTGCGAACAATCTATTGCCGAGCCTGGCAAACGTCAATTCTTGATGGATGCTTCAGAGATTTATGATGTACTTGCTGATAACACTGGTACTGGAGCTGTTTTGGGCATATCTTTGGACATATCTAAGATCAATGAGTTGTTTCTGAATGAAAGAGCTTTTGGTGGGATGCATAATCTGTTGTTTCTAAGATTCTACAAGTCCTCTTCGAGTAAAGATCAACCTGAGCTTCATTTACCTCGAGGCTTGGATTATTTACCCCGTAAACTTAGGCTGCTGCATTGGGATGCATTCCCCATGACATCAATGCCTCTGAGTTTTTGTCCACAGTTTCTTGTTGTGATAAACATAAGGGAGAGCCAGCTTGAGAAGCTGTGGGAAGGAACACAACCTCTTAGAAGTCTAAAGCAGATGGATTTAAGTAAGTCTGAGAATCTAAAAGAGATTCCTGATCTTTCGAAAGCGGTAAATATCGAGGAACTCTGTCTCAGTTATTGTGGAAGTTTGGTGATGTTACCTTCCTCGATCAAGAACCTCAACAAATTGGTTGTTCTTGACATGAAGTATTGCTCAAAGCTAGAGATTATCCCCTGCAATATGGACTTAGAGTCCCTTAGCATCCTCAATCTTGATGGATGCTCACGATTGGAGAGTTTTCCAGAAATTTCTTCGAAGATTGGATTTCTCTCTCTGTCAGAAACTGCAATAGAAGAAATTCCCACAACAGTCGCGTCTTGGCCATGTCTGGCAGCATTGGACATGTCAGGCTGCAAGAACCTCAAGACGTTTCCATGTCTTCCAAAAACTATAGAATGGTTGGATTTGAGCAGGACAGAGATCGAAGAAGTTCCTTTGTGGATCGATAAACTCTCAAAGCTCAATAAACTATTGATGAACAGCTGCATGAAGCTAAGAAGCATCTCTTCTGGGATCTCTACGCTGGAACATATCAAAACACTAGATTTTTTGGGGTGCAAGAATATTGTGAGCTTTCCTGTAGAGATATTCGAGAGCTCTCGGTTCTGTCATAATCTGGTGATGGAGATGAGAAACATTCAAAACCCTGATCTTCCTCGACCATTTTATTTCAAGAACAACTATATTGACACTATTCCAGATTGTATTACACGTCACTGCAAGCTGCCTTTTCTGAATTCATCAGGATCAATCTCCAGCAAGATAGAGAATGATTTCATCTGGTTCGATAAATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MEESSSLSLQSCNWRHHVFPSFSGKDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWREALVYIANIAGESSQNWDNEADLIDKIAMSISYELNSTLSRDSYNLVGIDNHMRELDSLLCLESTEVKMVGIWGPAGIGKTTIARALFNRLSENFQHTIFMENVKGSSRTSELDAYGFQLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDKLEQLDALVKQSQWFGSGSRIIVTTENKQLLRAHGITCIYELGFPSRSDSLQIFCQYAFGESSAPDGCIELATEITKLAGYLPLALKVLGSSLRGMSKDEQKSALPRLRTSLNEDIRNVLRVGYDGIHDKDKVIFLHIACLFNGENVDYVKQILASSGLDVTFGLQVLTSRSLIHISRCNRTITMHNLLEQLGREIVCEQSIAEPGKRQFLMDASEIYDVLADNTGTGAVLGISLDISKINELFLNERAFGGMHNLLFLRFYKSSSSKDQPELHLPRGLDYLPRKLRLLHWDAFPMTSMPLSFCPQFLVVINIRESQLEKLWEGTQPLRSLKQMDLSKSENLKEIPDLSKAVNIEELCLSYCGSLVMLPSSIKNLNKLVVLDMKYCSKLEIIPCNMDLESLSILNLDGCSRLESFPEISSKIGFLSLSETAIEEIPTTVASWPCLAALDMSGCKNLKTFPCLPKTIEWLDLSRTEIEEVPLWIDKLSKLNKLLMNSCMKLRSISSGISTLEHIKTLDFLGCKNIVSFPVEIFESSRFCHNLVMEMRNIQNPDLPRPFYFKNNYIDTIPDCITRHCKLPFLNSSGSISSKIENDFIWFDK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSLSLQSCNWRHHVFPSFSGKDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWREALVYIANIAGE

Gene3D: G3DSA:3.40.50.10140
13-141 G3DSA:3.40.50.10140

NWRHHVFPSFSGKDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWRE

ProfileScan: PS50104
IPR000157
14-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRHHVFPSFSGKDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWREALVYIANI

HMMSmart: SM00255
IPR000157
15-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RHHVFPSFSGKDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWREALVYIANI

HMMPfam: PF01582
IPR000157
18-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGKDVRRTFLSHLLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWREAL

HMMPanther: PTHR11017
35-851 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWREALVYIANIAGESSQNWDNEADLIDKIAMSISYELNSTLSRDSYNLVGIDNHMRELDSLLCLESTEVKMVGIWGPAGIGKTTIARALFNRLSENFQHTIFMENVKGSSRTSELDAYGFQLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDKLEQLDALVKQSQWFGSGSRIIVTTENKQLLRAHGITCIYELGFPSRSDSLQIFCQYAFGESSAPDGCIELATEITKLAGYLPLALKVLGSSLRGMSKDEQKSALPRLRTSLNEDIRNVLRVGYDGIHDKDKVIFLHIACLFNGENVDYVKQILASSGLDVTFGLQVLTSRSLIHISRCNRTITMHNLLEQLGREIVCEQSIAEPGKRQFLMDASEIYDVLADNTGTGAVLGISLDISKINELFLNERAFGGMHNLLFLRFYKSSSSKDQPELHLPRGLDYLPRKLRLLHWDAFPMTSMPLSFCPQFLVVINIRESQLEKLWEGTQPLRSLKQMDLSKSENLKEIPDLSKAVNIEELCLSYCGSLVMLPSSIKNLNKLVVLDMKYCSKLEIIPCNMDLESLSILNLDGCSRLESFPEISSKIGFLSLSETAIEEIPTTVASWPCLAALDMSGCKNLKTFPCLPKTIEWLDLSRTEIEEVPLWIDKLSKLNKLLMNSCMKLRSISSGISTLEHIKTLDFLGCKNIVSFPVEIFESSRFCHNLVMEMRNIQN

HMMPanther: PTHR11017:SF20
35-851 PTHR11017:SF20,SUBFAMILY NOT NAMED

LLKEFRRKGIRTFIDNDIKRSQMISSELVRAIRESRIAVVVLSRTYASSSWCLNELVEIKKVSQMIMPVFYEVDPSDVRKRTGEFGKAFEEACERQPDEEVKQKWREALVYIANIAGESSQNWDNEADLIDKIAMSISYELNSTLSRDSYNLVGIDNHMRELDSLLCLESTEVKMVGIWGPAGIGKTTIARALFNRLSENFQHTIFMENVKGSSRTSELDAYGFQLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDKLEQLDALVKQSQWFGSGSRIIVTTENKQLLRAHGITCIYELGFPSRSDSLQIFCQYAFGESSAPDGCIELATEITKLAGYLPLALKVLGSSLRGMSKDEQKSALPRLRTSLNEDIRNVLRVGYDGIHDKDKVIFLHIACLFNGENVDYVKQILASSGLDVTFGLQVLTSRSLIHISRCNRTITMHNLLEQLGREIVCEQSIAEPGKRQFLMDASEIYDVLADNTGTGAVLGISLDISKINELFLNERAFGGMHNLLFLRFYKSSSSKDQPELHLPRGLDYLPRKLRLLHWDAFPMTSMPLSFCPQFLVVINIRESQLEKLWEGTQPLRSLKQMDLSKSENLKEIPDLSKAVNIEELCLSYCGSLVMLPSSIKNLNKLVVLDMKYCSKLEIIPCNMDLESLSILNLDGCSRLESFPEISSKIGFLSLSETAIEEIPTTVASWPCLAALDMSGCKNLKTFPCLPKTIEWLDLSRTEIEEVPLWIDKLSKLNKLLMNSCMKLRSISSGISTLEHIKTLDFLGCKNIVSFPVEIFESSRFCHNLVMEMRNIQN

superfamily: SSF52540
169-417 SSF52540

MSISYELNSTLSRDSYNLVGIDNHMRELDSLLCLESTEVKMVGIWGPAGIGKTTIARALFNRLSENFQHTIFMENVKGSSRTSELDAYGFQLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDKLEQLDALVKQSQWFGSGSRIIVTTENKQLLRAHGITCIYELGFPSRSDSLQIFCQYAFGESSAPDGCIELATEITKLAGYLPLALKVLGSSLRGMSKDEQKSALPRLRTSLNEDI

HMMPfam: PF00931
IPR002182
190-449 NB-ARC,NBS
NB-ARC

DNHMRELDSLLCLESTEVKMVGIWGPAGIGKTTIARALFNRLSENFQHTIFMENVKGSSRTSELDAYGFQLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDKLEQLDALVKQSQWFGSGSRIIVTTENKQLLRAHGITCIYELGFPSRSDSLQIFCQYAFGESSAPDGCIELATEITKLAGYLPLALKVLGSSLRGMSKDEQKSALPRLRTSLNEDIRNVLRVGYDGIHDKDKVIFLHIACLFNGENVD

Gene3D: G3DSA:3.40.50.300
206-222 G3DSA:3.40.50.300

EVKMVGIWGPAGIGKTT

HMMSmart: SM00382
IPR003593
206-347 AAA,NBS
AAA+ ATPase domain

EVKMVGIWGPAGIGKTTIARALFNRLSENFQHTIFMENVKGSSRTSELDAYGFQLRLQEQFLSEVIDHKHMKIHDLGLVKERLQDLKVLVVLDDVDKLEQLDALVKQSQWFGSGSRIIVTTENKQLLRAHGITCIYELGFPS

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MVGIWGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
223-268 G3DSA:3.40.50.300

IARALFNRLSENFQHTIFMENVKGSSRTSELDAYGFQLRLQEQFLS

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

RLQDLKVLVVLDDVD

Gene3D: G3DSA:3.40.50.300
361-409 G3DSA:3.40.50.300

GESSAPDGCIELATEITKLAGYLPLALKVLGSSLRGMSKDEQKSALPRL

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AGYLPLALKVLGSSL

superfamily: SSF46785
415-523 SSF46785

EDIRNVLRVGYDGIHDKDKVIFLHIACLFNGENVDYVKQILASSGLDVTFGLQVLTSRSLIHISRCNRTITMHNLLEQLGREIVCEQSIAEPGKRQFLMDASEIYDVLA

superfamily: SSF52058
497-885 SSF52058,LRR

IVCEQSIAEPGKRQFLMDASEIYDVLADNTGTGAVLGISLDISKINELFLNERAFGGMHNLLFLRFYKSSSSKDQPELHLPRGLDYLPRKLRLLHWDAFPMTSMPLSFCPQFLVVINIRESQLEKLWEGTQPLRSLKQMDLSKSENLKEIPDLSKAVNIEELCLSYCGSLVMLPSSIKNLNKLVVLDMKYCSKLEIIPCNMDLESLSILNLDGCSRLESFPEISSKIGFLSLSETAIEEIPTTVASWPCLAALDMSGCKNLKTFPCLPKTIEWLDLSRTEIEEVPLWIDKLSKLNKLLMNSCMKLRSISSGISTLEHIKTLDFLGCKNIVSFPVEIFESSRFCHNLVMEMRNIQNPDLPRPFYFKNNYIDTIPDCITRHCKLPFLNSSG

Gene3D: G3DSA:3.80.10.10
535-883 G3DSA:3.80.10.10

SLDISKINELFLNERAFGGMHNLLFLRFYKSSSSKDQPELHLPRGLDYLPRKLRLLHWDAFPMTSMPLSFCPQFLVVINIRESQLEKLWEGTQPLRSLKQMDLSKSENLKEIPDLSKAVNIEELCLSYCGSLVMLPSSIKNLNKLVVLDMKYCSKLEIIPCNMDLESLSILNLDGCSRLESFPEISSKIGFLSLSETAIEEIPTTVASWPCLAALDMSGCKNLKTFPCLPKTIEWLDLSRTEIEEVPLWIDKLSKLNKLLMNSCMKLRSISSGISTLEHIKTLDFLGCKNIVSFPVEIFESSRFCHNLVMEMRNIQNPDLPRPFYFKNNYIDTIPDCITRHCKLPFLNS

HMMPfam: PF07725
IPR011713
608-627 LRR_3
Leucine-rich repeat 3

FLVVINIRESQLEKLWEGTQ

FPrintScan: PR00364
IPR000767
674-690 DISEASERSIST
Disease resistance protein

KNLNKLVVLDMKYCSKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox