PRGDB00046989 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18418481 (NM_121802)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G17970) mRNA, complete cds.

DNA Sequence

ATGGCTTCTGTTTCGTCCTCGTCTTCTTTTTCTGATCGCCATAGTTATCATGTGTTCCCTAGCTTCTGCGGGGAAGATGTACGTAGAAACTTTCTAAGTCATTTACACAAGGAGCTGCAACATAATGGAATTGATGCATTTAAAGATGGTGGAATCAAGAGAAGTCGTTCCATATGGCCTGAGCTTAAACAAGCTATATGGGAATCAAAGATTTTCATTGTTGTTCTTTCCAAGAACTACGCTGGTTCGTGCTGGTGCTTAGACGAATTGGTCGAGATCATGGAGTGCAGGGAAGTTGTTGGGAAGACATTGGTGCCGATTTTCTATGATGTGGATCCATCTAGTGTAAGAAAACAGACTGGAGATTTTGGAAAGGCTTTTGACAAGATTTGTGATGTGAGAACAGAGGAAGAGAGGCAGAGATGGAGGCAAGCTTTGACGAATGTTGGTAATATTGCCGGCGAGTGCTCTTCGAAATGGGACAATGACGCCAAAATGATTGAAAAGATCGTTGCTTATGTTTCTGAAGAGCTATTTTGCTTCACTTCTTCGACGGATTTCGAAGATTTACTTGGATTGGAAGCTCATGTTGCAAATTTGAAATCAATGTTAGGTCTAGAGTCTAATGAAGTGAAGATGATAGGTGTTTGGGGTCCTGCTGGAATAGGGAAGACCACTATCACGAGGATTTTATACAATCAACTTTCTTCATCTAATGATGACGACTTTCAATTGTTCATTTTCATGGAGAATGTTAAGGGAAGCTATAGGAGAAAGGAAATCGATGGTTATAGCATGAAGTTGCATTTACGAGAAAGGTTTCTCTCTGAAATTACCACCCAAAGAAAGATAAAGGTAAGCCATTTAGGTGTAGCACAAGAAAGGCTAAAGAATCAGAAAGCTCTTATTGTTCTTGATGATGTTGATGAACTGGAACAACTACGTGCCTTGGCAGATCAAACTCAATGGGTTGGTAATGGAACCAGAATTTTAGTTACTACAGAAGATAGACAGCTTTTGAAGGCTCATGGGATTACTCATGTATATGAAGTGGATTATCCATCTAGAGATGAAGCCTTAAAGATCTTGTGTCAATGTGCTTTCGGAAAAAACTCGGCACCAGAAGGATACAATGATCTAGCTGTTGAAGTTGTGGAACTTGCAGGATATCTTCCTTTAGGTCTCAGCGTTTTAGGTGCATCTTTGCGAGGGATGAGTAAGAAAGAGTGGATAAACGCTCTACCGCGACTTAGAACTAGTTTGAATGGGAAAATAGAGAAACTACTAAGAGTATGTTATGAAGGGTTAGATGAGAAAGATAAGGCTATCTTTCTTCATATCGCGTGCTTATTCAATGGCAAGAATGTTGATCGTGTGAAGCTGTTGCTTGCTAAGAGTGCATTGGATGTAGAATTTGGACTTAAAGTTCTTGTTGACAGATCTCTTATACACATAGATGCTGATGGATATATAGTCATGCATTGTTTGCTACAACAATTGGGTAAAGAAATCACTCGGGGACAGTGTCTCGACGAGCCCGGGAAACGTAAGTTTCTAGTTGATTCTTTGGAGATTTCAGATGTTCTTGCAGATGAAACCGGTACAGAAACTGTTTTAGGAATATCATTAGATATGTCTGAAATTGAAGATCAAGTGTATGTAAGTGAAAAAGCCTTTGAGAAAATGCCTAATCTCCAATTCTTGTGGCTATACAAGAATTTCCCAGATGAAGCAGTCAAGTTGTACTTACCTCACGGTTTGGATTATCTACCACGTAAACTTAGATTACTACATTGGGATTCGTATCCGAAAAAATGTTTGCCTTCTAAGTTTCGACCCGAATTTCTTGTGGAACTTACTATGAGAGATAGCAAGCTGGAGAAGCTCTGGGAAGGTATTCAGCCACTGAAAAGCCTCAAGCGTATGGATCTGAGTGCATCCACAAAGATTAAAGATATTCCAAACCTATCAAGAGCAACAAATCTGGAGAAGTTGTATCTTAGGTTCTGCAAAAATTTGGTCATAGTTCCTTCGTCTTGTCTACAGAATCTTCATAAGCTCAAAGTCTTGGACATGTCTTGTTGCATAAAACTGAAGAGTCTGCCAGACAACATCAACTTGAAATCCCTCAGTGTCCTTAATATGAGAGGATGCTCGAAGCTGAATAACTTTCCTTTGATTTCAACGCAGATTCAGTTCATGTCTCTAGGCGAAACTGCGATAGAGAAAGTGCCTTCAGTAATCAAGTTATGTTCTCGGCTTGTCTCATTGGAGATGGCGGGATGTAAGAACCTTAAAACATTACCATATTTGCCTGCAAGTATAGAGATCGTGGACATATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASVSSSSSFSDRHSYHVFPSFCGEDVRRNFLSHLHKELQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNVGNIAGECSSKWDNDAKMIEKIVAYVSEELFCFTSSTDFEDLLGLEAHVANLKSMLGLESNEVKMIGVWGPAGIGKTTITRILYNQLSSSNDDDFQLFIFMENVKGSYRRKEIDGYSMKLHLRERFLSEITTQRKIKVSHLGVAQERLKNQKALIVLDDVDELEQLRALADQTQWVGNGTRILVTTEDRQLLKAHGITHVYEVDYPSRDEALKILCQCAFGKNSAPEGYNDLAVEVVELAGYLPLGLSVLGASLRGMSKKEWINALPRLRTSLNGKIEKLLRVCYEGLDEKDKAIFLHIACLFNGKNVDRVKLLLAKSALDVEFGLKVLVDRSLIHIDADGYIVMHCLLQQLGKEITRGQCLDEPGKRKFLVDSLEISDVLADETGTETVLGISLDMSEIEDQVYVSEKAFEKMPNLQFLWLYKNFPDEAVKLYLPHGLDYLPRKLRLLHWDSYPKKCLPSKFRPEFLVELTMRDSKLEKLWEGIQPLKSLKRMDLSASTKIKDIPNLSRATNLEKLYLRFCKNLVIVPSSCLQNLHKLKVLDMSCCIKLKSLPDNINLKSLSVLNMRGCSKLNNFPLISTQIQFMSLGETAIEKVPSVIKLCSRLVSLEMAGCKNLKTLPYLPASIEIVDI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VSSSSSFSDRHSYHVFPSFCGEDVRRNFLSHLHKELQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNVGNIAGE

Gene3D: G3DSA:3.40.50.10140
12-149 G3DSA:3.40.50.10140

DRHSYHVFPSFCGEDVRRNFLSHLHKELQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNV

ProfileScan: PS50104
IPR000157
14-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

HSYHVFPSFCGEDVRRNFLSHLHKELQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNVGNI

HMMSmart: SM00255
IPR000157
15-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYHVFPSFCGEDVRRNFLSHLHKELQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNVGNI

HMMPfam: PF01582
IPR000157
18-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFCGEDVRRNFLSHLHKELQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALT

HMMPanther: PTHR11017
39-780 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNVGNIAGECSSKWDNDAKMIEKIVAYVSEELFCFTSSTDFEDLLGLEAHVANLKSMLGLESNEVKMIGVWGPAGIGKTTITRILYNQLSSSNDDDFQLFIFMENVKGSYRRKEIDGYSMKLHLRERFLSEITTQRKIKVSHLGVAQERLKNQKALIVLDDVDELEQLRALADQTQWVGNGTRILVTTEDRQLLKAHGITHVYEVDYPSRDEALKILCQCAFGKNSAPEGYNDLAVEVVELAGYLPLGLSVLGASLRGMSKKEWINALPRLRTSLNGKIEKLLRVCYEGLDEKDKAIFLHIACLFNGKNVDRVKLLLAKSALDVEFGLKVLVDRSLIHIDADGYIVMHCLLQQLGKEITRGQCLDEPGKRKFLVDSLEISDVLADETGTETVLGISLDMSEIEDQVYVSEKAFEKMPNLQFLWLYKNFPDEAVKLYLPHGLDYLPRKLRLLHWDSYPKKCLPSKFRPEFLVELTMRDSKLEKLWEGIQPLKSLKRMDLSASTKIKDIPNLSRATNLEKLYLRFCKNLVIVPSSCLQNLHKLKVLDMSCCIKLKSLPDNINLKSLSVLNMRGCSKLNNFPLISTQIQFMSLGETAIEKVPSVIKLCSRLVSLEMAGCKNLKTLPYLPASIEIVDI

HMMPanther: PTHR11017:SF20
39-780 PTHR11017:SF20,SUBFAMILY NOT NAMED

LQHNGIDAFKDGGIKRSRSIWPELKQAIWESKIFIVVLSKNYAGSCWCLDELVEIMECREVVGKTLVPIFYDVDPSSVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNVGNIAGECSSKWDNDAKMIEKIVAYVSEELFCFTSSTDFEDLLGLEAHVANLKSMLGLESNEVKMIGVWGPAGIGKTTITRILYNQLSSSNDDDFQLFIFMENVKGSYRRKEIDGYSMKLHLRERFLSEITTQRKIKVSHLGVAQERLKNQKALIVLDDVDELEQLRALADQTQWVGNGTRILVTTEDRQLLKAHGITHVYEVDYPSRDEALKILCQCAFGKNSAPEGYNDLAVEVVELAGYLPLGLSVLGASLRGMSKKEWINALPRLRTSLNGKIEKLLRVCYEGLDEKDKAIFLHIACLFNGKNVDRVKLLLAKSALDVEFGLKVLVDRSLIHIDADGYIVMHCLLQQLGKEITRGQCLDEPGKRKFLVDSLEISDVLADETGTETVLGISLDMSEIEDQVYVSEKAFEKMPNLQFLWLYKNFPDEAVKLYLPHGLDYLPRKLRLLHWDSYPKKCLPSKFRPEFLVELTMRDSKLEKLWEGIQPLKSLKRMDLSASTKIKDIPNLSRATNLEKLYLRFCKNLVIVPSSCLQNLHKLKVLDMSCCIKLKSLPDNINLKSLSVLNMRGCSKLNNFPLISTQIQFMSLGETAIEKVPSVIKLCSRLVSLEMAGCKNLKTLPYLPASIEIVDI

superfamily: SSF52540
173-425 SSF52540

YVSEELFCFTSSTDFEDLLGLEAHVANLKSMLGLESNEVKMIGVWGPAGIGKTTITRILYNQLSSSNDDDFQLFIFMENVKGSYRRKEIDGYSMKLHLRERFLSEITTQRKIKVSHLGVAQERLKNQKALIVLDDVDELEQLRALADQTQWVGNGTRILVTTEDRQLLKAHGITHVYEVDYPSRDEALKILCQCAFGKNSAPEGYNDLAVEVVELAGYLPLGLSVLGASLRGMSKKEWINALPRLRTSLNGKI

Gene3D: G3DSA:3.40.50.300
178-342 G3DSA:3.40.50.300

LFCFTSSTDFEDLLGLEAHVANLKSMLGLESNEVKMIGVWGPAGIGKTTITRILYNQLSSSNDDDFQLFIFMENVKGSYRRKEIDGYSMKLHLRERFLSEITTQRKIKVSHLGVAQERLKNQKALIVLDDVDELEQLRALADQTQWVGNGTRILVTTEDRQLLKA

HMMPfam: PF00931
IPR002182
194-461 NB-ARC,NBS
NB-ARC

EAHVANLKSMLGLESNEVKMIGVWGPAGIGKTTITRILYNQLSSSNDDDFQLFIFMENVKGSYRRKEIDGYSMKLHLRERFLSEITTQRKIKVSHLGVAQERLKNQKALIVLDDVDELEQLRALADQTQWVGNGTRILVTTEDRQLLKAHGITHVYEVDYPSRDEALKILCQCAFGKNSAPEGYNDLAVEVVELAGYLPLGLSVLGASLRGMSKKEWINALPRLRTSLNGKIEKLLRVCYEGLDEKDKAIFLHIACLFNGKNVDRVKL

HMMSmart: SM00382
IPR003593
210-354 AAA,NBS
AAA+ ATPase domain

EVKMIGVWGPAGIGKTTITRILYNQLSSSNDDDFQLFIFMENVKGSYRRKEIDGYSMKLHLRERFLSEITTQRKIKVSHLGVAQERLKNQKALIVLDDVDELEQLRALADQTQWVGNGTRILVTTEDRQLLKAHGITHVYEVDYP

FPrintScan: PR00364
IPR000767
213-228 DISEASERSIST
Disease resistance protein

MIGVWGPAGIGKTTIT

FPrintScan: PR00364
IPR000767
295-309 DISEASERSIST
Disease resistance protein

RLKNQKALIVLDDVD

FPrintScan: PR00364
IPR000767
388-402 DISEASERSIST
Disease resistance protein

AGYLPLGLSVLGASL

superfamily: SSF46785
423-530 SSF46785

GKIEKLLRVCYEGLDEKDKAIFLHIACLFNGKNVDRVKLLLAKSALDVEFGLKVLVDRSLIHIDADGYIVMHCLLQQLGKEITRGQCLDEPGKRKFLVDSLEISDVLA

superfamily: SSF52058
504-780 SSF52058,LRR

ITRGQCLDEPGKRKFLVDSLEISDVLADETGTETVLGISLDMSEIEDQVYVSEKAFEKMPNLQFLWLYKNFPDEAVKLYLPHGLDYLPRKLRLLHWDSYPKKCLPSKFRPEFLVELTMRDSKLEKLWEGIQPLKSLKRMDLSASTKIKDIPNLSRATNLEKLYLRFCKNLVIVPSSCLQNLHKLKVLDMSCCIKLKSLPDNINLKSLSVLNMRGCSKLNNFPLISTQIQFMSLGETAIEKVPSVIKLCSRLVSLEMAGCKNLKTLPYLPASIEIVDI

Gene3D: G3DSA:3.80.10.10
554-770 G3DSA:3.80.10.10

VSEKAFEKMPNLQFLWLYKNFPDEAVKLYLPHGLDYLPRKLRLLHWDSYPKKCLPSKFRPEFLVELTMRDSKLEKLWEGIQPLKSLKRMDLSASTKIKDIPNLSRATNLEKLYLRFCKNLVIVPSSCLQNLHKLKVLDMSCCIKLKSLPDNINLKSLSVLNMRGCSKLNNFPLISTQIQFMSLGETAIEKVPSVIKLCSRLVSLEMAGCKNLKTLPY

HMMPfam: PF07725
IPR011713
615-634 LRR_3
Leucine-rich repeat 3

FLVELTMRDSKLEKLWEGIQ

HMMPfam: PF13855
660-718 LRR_8,Leucine rich repeat

TNLEKLYLRFCKNLVIVPSSCLQNLHKLKVLDMSCCIKLKSLPDNINLKSLSVLNMRGC

FPrintScan: PR00364
IPR000767
682-698 DISEASERSIST
Disease resistance protein

QNLHKLKVLDMSCCIKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox