PRGDB00046991 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422107 (NM_123518)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G41540) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCGACCCACGTTAGGAAATATCATGTCTTCCCGAGCTTCCACGGCTCAGACGTTCGTAGAAAATTTCTCAGTCATTTACGTTTTCACTTTGCAATCAAGGGAATCGTGGCATTTAAAGACCAAGAGATTGAACGAGGCCAGAGGATCGGACCTGAACTGGTGCAAGCAATACGAGAATCTAGAGTGTCGCTGGTGGTGCTATCTAAGAATTACCCTTCTTCAAGCTGGTGTTTAGATGAATTGGTAGAAATCTTAAAATGCAAAGAAGATCAGGAGCAGATTGTGATGCCTATATTTTACGAAATCGACCCGTCTGATGTACGGAAACAGAGCGGTGATTTCGGAAAGGCGTTTGGGAAAACTTGTGTAGGTAAAACTAAGGAGGTGAAGCAGAGATGGACCAACGCTTTGACTGAGGCGGCAAACATAGGAGGAGAACATTCTCTAAACTGGACTGATGAAGCTGAGATGATTGAAAAGATTGTCGCAGATGTTTCAAACAAACTGAATGTCATACCATCAAGGGATTTTGAAGAGATGGTGGGACTTGACGCTCACTTGAGGAAATTGGACTCTTTGTTATGTCTCAATTCTGATGAAGTGAAGATGATTGGAATTTGGGGTCCTGCAGGAATTGGTAAGACTACCATTGCTAGAGCTTTATACAACCAACTCTCTACGAATTTTCAATTTAAATGCTTTATGGGAAACCTCAAAGGAAGTTATAAGAGCATTGGTGTTGATAACTATGATTGGAAGTTGAATTTACAAAACCAACTTCTGTCCAAGATTTTGAACCAAAATGATGTGAAGACAGATCATTTAGGGGGAATAAAAGACTGGCTAGAGGATAAAAAAGTTCTTATAGTTATTGATGATGTGGATGATCTAGAGCAACTATTGGCATTGGCTAAAGAACCTTCTTGGTTTGGTTCCGGAAGTCGAATCATCGTTACCACAAAAGATAAAACTATTATGAAGACACTTTTGGTCAACGACAACAACTTTTACCATGTCGGTTATCCAACCAATAAGGTAGCTCTTGAGATCCTCTGTCTGTCTGCTTTTCAGAAAAGTTTTCCACGGGATGGTTTTGAAGAGCTTGCAAGAAAAGTAGCTTATCTTTGTGGTAATCTTCCATTATGCCTTTCTGTTGTGGGTTCATCTTTGCGTGGCCAGAGCAAGCATAGATGGAAACTACAATCGGATAGGCTAGAAACTAGTCTTGATAGAAAGATTGAGGACGTATTAAAATCGGCATATGAAAAATTGTCCAAGAAAGAGCAAGTTCTCTTTCTTCACATTGCATGCTTCTTCAACAATACATACATTAGTGTTGTGAAAACGTTACTTGCTGATAGTAACCTGGACGTCAGAAATGGGTTGAAGACCCTAGCCGATAAATGTCTTGTACATATATCCAGGGTTGACCGGATATTTATGCATCCTTTGCTTCAACAATTAGGTAGATACATAGTTCTTGAACAGTCCGATGAGCCCGAGAAACGTCAGTTTCTAGTAGAGGCCGAAGAGATTCGTGATGTGTTGGCAAATGAAACCGGTACTGGATCTGTATTAGGAATATCATTTGACATGTCTAAGGTCAGTGAGTTCTCTATAAGTGGGCGAGCCTTTGAAGCAATGCGTAATCTTCGATTCTTAAGAATTTATCGGAGAAGTTCTAGTAAAAAGGTTACATTACGGATAGTAGAAGACATGAAGTATCTACCTCGGCTAAGGTTACTACATTGGGAACATTACCCAAGAAAAAGTCTTCCTCGGAGATTCCAGCCAGAACGTCTCGTGGTACTCCATATGCCACACAGCAATCTAGAGAAGCTCTGGGGAGGAATCCAGTCCCTTACAAATCTCAAGAATATAGATTTGAGCTTTTCGCGTAAGTTGAAAGAAATTCCTAATCTTTCAAATGCTACTAATCTTGAGACATTGACACTTATTAAGTGCTCAAGTTTGGTGGAGCTTCCCTCTTCCATTTCGAATCTACAAAAACTGAAAGCGTTGATGATGTTTGGGTGTAAAATGTTAAAAGTTGTTCCAACCAACATCAACTTAGTATCTCTTGAGAAAGTCAGCATGACTCTGTGCTCACAGTTGAGCAGTTTTCCAGATATTTCGAGGAACATCAAATCTCTTGATGTAGGAAAAACAAAGATAGAAGAAGTTCCTCCATCAGTTGTTAAATATTGGTCTCGTCTTGATCAACTTAGCTTAGAATGCCGAAGCCTCAAGAGATTAACATATGTCCCGCCAAGCATAACTATGCTAAGCCTAAGCTTTAGTGATATAGAGACGATTCCAGATTGCGTCATACGTCTCACTCGGTTACGAACTCTTACCATCAAATGCTGCAGAAAACTTGTTTCGTTGCCAGGTCTTCCTCCTTCCCTAGAGTTCCTATGTGCAAACCATTGTCGATCACTTGAGAGAGTACATTCTTTCCATAACCCAGTCAAGTTACTTATATTCCACAATTGTTTAAAACTGGATGAAAAAGCAAGAAGAGCAATCAAACAACAAAGGGTTGAAGGGTATATATGGTTACCTGGCAAAAAAGTCCCTGCGGAGTTCACTCACAAAGCTACAGGAAACTCCATAACCATCCCTCTGGCTCCAGTTGCGGGGACTTTCTCGGTGTCCTCAAGATTCAAGGCTTGCCTTCTCTTTTCGCCAATCGAAGACTTCCCAACTAATGATATAACATGTCGTCTAAGAATCAAAGGAGGTGTCCAAATTAACAAATTCTATCACCGGGTAGTGATTCTAGAGTCGTCTAAAATTCGAACAGAACATCTGTTTATATTTTATGGTGACTTGTTTTCAGAAAAAATAGGCGTAGATGTGAGTACAAGCGAGATTCTGTTTAAATTCAGCTGCAGGGATAAGCACAAGATCATTGAGTGTGGTGTACAGATCTTTAAGGAGGAAGCTGAGAGTAGCAGCAGCAGCAGCGAAGAGGAATACTTTGATGCTGAAAGTAGCAGCAACGAAGAGGAATATTTTGATTTTGAGAGTAGCAGCAGCAGCGAAGAGGACTACTTTGATGCTGAGAGTAGTAGCCGCGAATGCTGGAGATGGAGACTATGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSTHVRKYHVFPSFHGSDVRRKFLSHLRFHFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALTEAANIGGEHSLNWTDEAEMIEKIVADVSNKLNVIPSRDFEEMVGLDAHLRKLDSLLCLNSDEVKMIGIWGPAGIGKTTIARALYNQLSTNFQFKCFMGNLKGSYKSIGVDNYDWKLNLQNQLLSKILNQNDVKTDHLGGIKDWLEDKKVLIVIDDVDDLEQLLALAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNNFYHVGYPTNKVALEILCLSAFQKSFPRDGFEELARKVAYLCGNLPLCLSVVGSSLRGQSKHRWKLQSDRLETSLDRKIEDVLKSAYEKLSKKEQVLFLHIACFFNNTYISVVKTLLADSNLDVRNGLKTLADKCLVHISRVDRIFMHPLLQQLGRYIVLEQSDEPEKRQFLVEAEEIRDVLANETGTGSVLGISFDMSKVSEFSISGRAFEAMRNLRFLRIYRRSSSKKVTLRIVEDMKYLPRLRLLHWEHYPRKSLPRRFQPERLVVLHMPHSNLEKLWGGIQSLTNLKNIDLSFSRKLKEIPNLSNATNLETLTLIKCSSLVELPSSISNLQKLKALMMFGCKMLKVVPTNINLVSLEKVSMTLCSQLSSFPDISRNIKSLDVGKTKIEEVPPSVVKYWSRLDQLSLECRSLKRLTYVPPSITMLSLSFSDIETIPDCVIRLTRLRTLTIKCCRKLVSLPGLPPSLEFLCANHCRSLERVHSFHNPVKLLIFHNCLKLDEKARRAIKQQRVEGYIWLPGKKVPAEFTHKATGNSITIPLAPVAGTFSVSSRFKACLLFSPIEDFPTNDITCRLRIKGGVQINKFYHRVVILESSKIRTEHLFIFYGDLFSEKIGVDVSTSEILFKFSCRDKHKIIECGVQIFKEEAESSSSSSEEEYFDAESSSNEEEYFDFESSSSSEEDYFDAESSSRECWRWRL

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSTHVRKYHVFPSFHGSDVRRKFLSHLRFHFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALTEAANIGGE

ProfileScan: PS50104
IPR000157
9-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RKYHVFPSFHGSDVRRKFLSHLRFHFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALTEAANI

Gene3D: G3DSA:3.40.50.10140
9-141 G3DSA:3.40.50.10140

RKYHVFPSFHGSDVRRKFLSHLRFHFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNAL

HMMSmart: SM00255
IPR000157
10-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYHVFPSFHGSDVRRKFLSHLRFHFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALTEAANI

HMMPfam: PF01582
IPR000157
13-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGSDVRRKFLSHLRFHFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALT

HMMPanther: PTHR11017:SF20
33-1037 PTHR11017:SF20,SUBFAMILY NOT NAMED

HFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALTEAANIGGEHSLNWTDEAEMIEKIVADVSNKLNVIPSRDFEEMVGLDAHLRKLDSLLCLNSDEVKMIGIWGPAGIGKTTIARALYNQLSTNFQFKCFMGNLKGSYKSIGVDNYDWKLNLQNQLLSKILNQNDVKTDHLGGIKDWLEDKKVLIVIDDVDDLEQLLALAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNNFYHVGYPTNKVALEILCLSAFQKSFPRDGFEELARKVAYLCGNLPLCLSVVGSSLRGQSKHRWKLQSDRLETSLDRKIEDVLKSAYEKLSKKEQVLFLHIACFFNNTYISVVKTLLADSNLDVRNGLKTLADKCLVHISRVDRIFMHPLLQQLGRYIVLEQSDEPEKRQFLVEAEEIRDVLANETGTGSVLGISFDMSKVSEFSISGRAFEAMRNLRFLRIYRRSSSKKVTLRIVEDMKYLPRLRLLHWEHYPRKSLPRRFQPERLVVLHMPHSNLEKLWGGIQSLTNLKNIDLSFSRKLKEIPNLSNATNLETLTLIKCSSLVELPSSISNLQKLKALMMFGCKMLKVVPTNINLVSLEKVSMTLCSQLSSFPDISRNIKSLDVGKTKIEEVPPSVVKYWSRLDQLSLECRSLKRLTYVPPSITMLSLSFSDIETIPDCVIRLTRLRTLTIKCCRKLVSLPGLPPSLEFLCANHCRSLERVHSFHNPVKLLIFHNCLKLDEKARRAIKQQRVEGYIWLPGKKVPAEFTHKATGNSITIPLAPVAGTFSVSSRFKACLLFSPIEDFPTNDITCRLRIKGGVQINKFYHRVVILESSKIRTEHLFIFYGDLFSEKIGVDVSTSEILFKFSCRDKHKIIECGVQIFKEEAESSSSSSEEEYFDAESSSNEEEYFDFESSSSSEEDYFDAESSSRECWRWR

HMMPanther: PTHR11017
33-1037 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HFAIKGIVAFKDQEIERGQRIGPELVQAIRESRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALTEAANIGGEHSLNWTDEAEMIEKIVADVSNKLNVIPSRDFEEMVGLDAHLRKLDSLLCLNSDEVKMIGIWGPAGIGKTTIARALYNQLSTNFQFKCFMGNLKGSYKSIGVDNYDWKLNLQNQLLSKILNQNDVKTDHLGGIKDWLEDKKVLIVIDDVDDLEQLLALAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNNFYHVGYPTNKVALEILCLSAFQKSFPRDGFEELARKVAYLCGNLPLCLSVVGSSLRGQSKHRWKLQSDRLETSLDRKIEDVLKSAYEKLSKKEQVLFLHIACFFNNTYISVVKTLLADSNLDVRNGLKTLADKCLVHISRVDRIFMHPLLQQLGRYIVLEQSDEPEKRQFLVEAEEIRDVLANETGTGSVLGISFDMSKVSEFSISGRAFEAMRNLRFLRIYRRSSSKKVTLRIVEDMKYLPRLRLLHWEHYPRKSLPRRFQPERLVVLHMPHSNLEKLWGGIQSLTNLKNIDLSFSRKLKEIPNLSNATNLETLTLIKCSSLVELPSSISNLQKLKALMMFGCKMLKVVPTNINLVSLEKVSMTLCSQLSSFPDISRNIKSLDVGKTKIEEVPPSVVKYWSRLDQLSLECRSLKRLTYVPPSITMLSLSFSDIETIPDCVIRLTRLRTLTIKCCRKLVSLPGLPPSLEFLCANHCRSLERVHSFHNPVKLLIFHNCLKLDEKARRAIKQQRVEGYIWLPGKKVPAEFTHKATGNSITIPLAPVAGTFSVSSRFKACLLFSPIEDFPTNDITCRLRIKGGVQINKFYHRVVILESSKIRTEHLFIFYGDLFSEKIGVDVSTSEILFKFSCRDKHKIIECGVQIFKEEAESSSSSSEEEYFDAESSSNEEEYFDFESSSSSEEDYFDAESSSRECWRWR

superfamily: SSF52540
64-426 SSF52540

SRVSLVVLSKNYPSSSWCLDELVEILKCKEDQEQIVMPIFYEIDPSDVRKQSGDFGKAFGKTCVGKTKEVKQRWTNALTEAANIGGEHSLNWTDEAEMIEKIVADVSNKLNVIPSRDFEEMVGLDAHLRKLDSLLCLNSDEVKMIGIWGPAGIGKTTIARALYNQLSTNFQFKCFMGNLKGSYKSIGVDNYDWKLNLQNQLLSKILNQNDVKTDHLGGIKDWLEDKKVLIVIDDVDDLEQLLALAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNNFYHVGYPTNKVALEILCLSAFQKSFPRDGFEELARKVAYLCGNLPLCLSVVGSSLRGQSKHRWKLQSDRLETSLDRKIEDVLKSAYE

HMMPfam: PF00931
IPR002182
189-451 NB-ARC,NBS
NB-ARC

AHLRKLDSLLCLNSDEVKMIGIWGPAGIGKTTIARALYNQLSTNFQFKCFMGNLKGSYKSIGVDNYDWKLNLQNQLLSKILNQNDVKTDHLGGIKDWLEDKKVLIVIDDVDDLEQLLALAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNNFYHVGYPTNKVALEILCLSAFQKSFPRDGFEELARKVAYLCGNLPLCLSVVGSSLRGQSKHRWKLQSDRLETSLDRKIEDVLKSAYEKLSKKEQVLFLHIACFFNNTYISVV

Gene3D: G3DSA:3.40.50.300
190-251 G3DSA:3.40.50.300

HLRKLDSLLCLNSDEVKMIGIWGPAGIGKTTIARALYNQLSTNFQFKCFMGNLKGSYKSIGV

HMMSmart: SM00382
IPR003593
204-340 AAA,NBS
AAA+ ATPase domain

EVKMIGIWGPAGIGKTTIARALYNQLSTNFQFKCFMGNLKGSYKSIGVDNYDWKLNLQNQLLSKILNQNDVKTDHLGGIKDWLEDKKVLIVIDDVDDLEQLLALAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNNF

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

MIGIWGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
268-429 G3DSA:3.40.50.300

ILNQNDVKTDHLGGIKDWLEDKKVLIVIDDVDDLEQLLALAKEPSWFGSGSRIIVTTKDKTIMKTLLVNDNNFYHVGYPTNKVALEILCLSAFQKSFPRDGFEELARKVAYLCGNLPLCLSVVGSSLRGQSKHRWKLQSDRLETSLDRKIEDVLKSAYEKLS

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

WLEDKKVLIVIDDVD

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

CGNLPLCLSVVGSSL

superfamily: SSF46785
415-521 SSF46785

RKIEDVLKSAYEKLSKKEQVLFLHIACFFNNTYISVVKTLLADSNLDVRNGLKTLADKCLVHISRVDRIFMHPLLQQLGRYIVLEQSDEPEKRQFLVEAEEIRDVLA

superfamily: SSF52058
515-839 SSF52058,LRR

EIRDVLANETGTGSVLGISFDMSKVSEFSISGRAFEAMRNLRFLRIYRRSSSKKVTLRIVEDMKYLPRLRLLHWEHYPRKSLPRRFQPERLVVLHMPHSNLEKLWGGIQSLTNLKNIDLSFSRKLKEIPNLSNATNLETLTLIKCSSLVELPSSISNLQKLKALMMFGCKMLKVVPTNINLVSLEKVSMTLCSQLSSFPDISRNIKSLDVGKTKIEEVPPSVVKYWSRLDQLSLECRSLKRLTYVPPSITMLSLSFSDIETIPDCVIRLTRLRTLTIKCCRKLVSLPGLPPSLEFLCANHCRSLERVHSFHNPVKLLIFHNCLKL

Gene3D: G3DSA:3.80.10.10
535-819 G3DSA:3.80.10.10

DMSKVSEFSISGRAFEAMRNLRFLRIYRRSSSKKVTLRIVEDMKYLPRLRLLHWEHYPRKSLPRRFQPERLVVLHMPHSNLEKLWGGIQSLTNLKNIDLSFSRKLKEIPNLSNATNLETLTLIKCSSLVELPSSISNLQKLKALMMFGCKMLKVVPTNINLVSLEKVSMTLCSQLSSFPDISRNIKSLDVGKTKIEEVPPSVVKYWSRLDQLSLECRSLKRLTYVPPSITMLSLSFSDIETIPDCVIRLTRLRTLTIKCCRKLVSLPGLPPSLEFLCANHCRSLE

HMMPfam: PF07725
IPR011713
605-623 LRR_3
Leucine-rich repeat 3

LVVLHMPHSNLEKLWGGIQ

FPrintScan: PR00364
IPR000767
623-639 DISEASERSIST
Disease resistance protein

QSLTNLKNIDLSFSRKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox