PRGDB00046992 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145358950 (NM_124096)
Gene Class CNL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT5G47250) mRNA, complete cds.

DNA Sequence

ATGAATTGCTGTTGGCAGGTAGTTGAGCCATGTTATAAGTCTGCTTTGTCTTACTTGTGTGTAAAGGTGGGTAACATTTGCATGTTGAAGGAAAATCTTGTCTTGTTGAAGAGTGCTTTTGATGAGCTTAAAGCAGAAAAAGAAGATGTTGTAAACAGAGTCAATGCTGGTGAGCTTAAGGGTGGTCAACGGCTAGCTATAGTGGCTACGTGGCTTTCACAAGTCGAAATCATTGAGGAAAACACCAAACAGTTAATGGATGTTGCGTCCGCTCGGGATGCTTCTTCTCAGAATGCTTCAGCTGTACGTCGACGTCTGTCAACATCTGGGTGCTGGTTCTCAACCTGCAACCTAGGCGAGAAGGTATTCAAGAAGTTGACTGAAGTTAAAAGTCTCTCCGGTAAAGATTTTCAAGAAGTGACTGAGCAACCTCCTCCTCCTGTGGTAGAAGTGAGACTTTGCCAACAAACAGTCGGTCTTGATACGACGCTTGAAAAGACTTGGGAAAGTCTTAGAAAAGATGAAAACAGAATGTTGGGAATCTTCGGTATGGGAGGCGTAGGCAAAACTACCCTCCTCACTCTAATTAACAACAAGTTCGTTGAAGTCAGTGATGATTATGATGTTGTTATTTGGGTTGAATCGTCTAAAGATGCAGATGTCGGGAAGATTCAAGATGCCATCGGGGAAAGATTACACATCTGTGACAATAATTGGTCTACATACTCAAGAGGGAAGAAAGCTAGTGAAATAAGCAGGGTACTAAGAGATATGAAGCCCCGGTTCGTGCTGTTATTAGATGACTTATGGGAGGATGTGAGTTTAACAGCAATAGGCATCCCAGTGCTCGGTAAAAAATACAAAGTCGTGTTTACTACTCGTTCTAAGGATGTCTGTTCAGTTATGAGGGCAAATGAGGACATAGAAGTTCAATGTTTGTCGGAGAATGACGCATGGGATTTGTTCGATATGAAGGTCCATTGCGACGGGTTAAATGAAATTTCTGATATTGCAAAAAAGATTGTGGCTAAGTGTTGTGGCTTACCCCTTGCACTTGAAGTTATAAGAAAGACTATGGCATCTAAATCTACTGTGATTCAATGGCGTCGTGCACTCGATACTTTGGAGTCTTATCGGAGTGAGATGAAAGGTACAGAGAAGGGAATATTTCAAGTTTTGAAGTTGAGCTATGATTATTTGAAAACAAAAAATGCCAAGTGTTTTCTGTATTGTGCTTTATTTCCCAAGGCATATTATATCAAACAAGATGAGCTGGTAGAGTATTGGATAGGTGAGGGTTTCATAGATGAAAAAGACGGAAGAGAGAGAGCAAAAGATCGAGGCTATGAGATCATCGATAATCTTGTTGGGGCAGGTTTGTTATTAGAGTCTAATAAGAAAGTGTATATGCATGATATGATCCGTGATATGGCATTGTGGATAGTATCTGAATTTAGGGATGGAGAAAGATATGTTGTGAAAACAGATGCTGGTTTAAGCCAACTGCCTGATGTCACCGATTGGACAACTGTGACAAAGATGTCTCTGTTCAACAATGAGATTAAGAACATACCAGACGATCCTGAATTTCCTGACCAGACAAATCTTGTAACCTTGTTCCTTCAAAATAACAGGTTGGTAGATATTGTTGGTAAATTCTTTCTGGTCATGTCGACTCTGGTGGTTTTGGATCTATCTTGGAACTTCCAAATCACCGAGTTGCCAAAAGGAATCTCGGCGTTGGTTTCTTTGCGGCTTCTCAACTTATCAGGGACGAGTATAAAGCATCTGCCGGAAGGTTTAGGAGTCTTGAGTAAATTGATTCACTTGAATTTGGAGTCCACTTCCAATCTTCGAAGCGTCGGTCTGATTTCAGAATTACAAAAGTTGCAGGTTCTCAGATTTTATGGTTCTGCTGCTGCATTAGATTGCTGCTTGCTCAAGATCTTGGAGCAGTTGAAGGGTTTACAACTTTTGACCGTTACTGTGAATAACGATTCTGTTTTGGAAGAGTTTCTAGGAAGCACAAGATTGGCAGGGATGACGCAGGGTATATATCTAGAAGGACTTAAAGTATCATTTGCAGCCATTGGTACGTTGAGTAGTCTCCACAAACTTGAAATGGTAAACTGCGATATCACAGAGTCGGGAACAGAATGGGAAGGTAAGAGAAGAGACCAGTATTCTCCATCCACATCATCCAGTGAAATCACTCCAAGCAATCCATGGTTCAAGGATCTCTCAGCTGTGGTAATAAACTCATGCATACATCTAAAGGATTTGACATGGCTGATGTATGCTGCAAATCTCGAGTCTCTAAGCGTGGAATCCTCGCCTAAGATGACAGAATTAATAAACAAAGAGAAAGCTCAAGGTGTTGGGGTTGATCCTTTTCAAGAGCTACAAGTCCTTCGTCTACATTATTTGAAGGAACTAGGAAGCATCTATGGGAGTCAAGTCTCTTTTCCAAAACTGAAGCTGAACAAAGTCGATATAGAAAACTGCCCGAATCTTCATCAACGTCCATTATAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MNCCWQVVEPCYKSALSYLCVKVGNICMLKENLVLLKSAFDELKAEKEDVVNRVNAGELKGGQRLAIVATWLSQVEIIEENTKQLMDVASARDASSQNASAVRRRLSTSGCWFSTCNLGEKVFKKLTEVKSLSGKDFQEVTEQPPPPVVEVRLCQQTVGLDTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDADVGKIQDAIGERLHICDNNWSTYSRGKKASEISRVLRDMKPRFVLLLDDLWEDVSLTAIGIPVLGKKYKVVFTTRSKDVCSVMRANEDIEVQCLSENDAWDLFDMKVHCDGLNEISDIAKKIVAKCCGLPLALEVIRKTMASKSTVIQWRRALDTLESYRSEMKGTEKGIFQVLKLSYDYLKTKNAKCFLYCALFPKAYYIKQDELVEYWIGEGFIDEKDGRERAKDRGYEIIDNLVGAGLLLESNKKVYMHDMIRDMALWIVSEFRDGERYVVKTDAGLSQLPDVTDWTTVTKMSLFNNEIKNIPDDPEFPDQTNLVTLFLQNNRLVDIVGKFFLVMSTLVVLDLSWNFQITELPKGISALVSLRLLNLSGTSIKHLPEGLGVLSKLIHLNLESTSNLRSVGLISELQKLQVLRFYGSAAALDCCLLKILEQLKGLQLLTVTVNNDSVLEEFLGSTRLAGMTQGIYLEGLKVSFAAIGTLSSLHKLEMVNCDITESGTEWEGKRRDQYSPSTSSSEITPSNPWFKDLSAVVINSCIHLKDLTWLMYAANLESLSVESSPKMTELINKEKAQGVGVDPFQELQVLRLHYLKELGSIYGSQVSFPKLKLNKVDIENCPNLHQRPL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
12-842 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YKSALSYLCVKVGNICMLKENLVLLKSAFDELKAEKEDVVNRVNAGELKGGQRLAIVATWLSQVEIIEENTKQLMDVASARDASSQNASAVRRRLSTSGCWFSTCNLGEKVFKKLTEVKSLSGKDFQEVTEQPPPPVVEVRLCQQTVGLDTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDADVGKIQDAIGERLHICDNNWSTYSRGKKASEISRVLRDMKPRFVLLLDDLWEDVSLTAIGIPVLGKKYKVVFTTRSKDVCSVMRANEDIEVQCLSENDAWDLFDMKVHCDGLNEISDIAKKIVAKCCGLPLALEVIRKTMASKSTVIQWRRALDTLESYRSEMKGTEKGIFQVLKLSYDYLKTKNAKCFLYCALFPKAYYIKQDELVEYWIGEGFIDEKDGRERAKDRGYEIIDNLVGAGLLLESNKKVYMHDMIRDMALWIVSEFRDGERYVVKTDAGLSQLPDVTDWTTVTKMSLFNNEIKNIPDDPEFPDQTNLVTLFLQNNRLVDIVGKFFLVMSTLVVLDLSWNFQITELPKGISALVSLRLLNLSGTSIKHLPEGLGVLSKLIHLNLESTSNLRSVGLISELQKLQVLRFYGSAAALDCCLLKILEQLKGLQLLTVTVNNDSVLEEFLGSTRLAGMTQGIYLEGLKVSFAAIGTLSSLHKLEMVNCDITESGTEWEGKRRDQYSPSTSSSEITPSNPWFKDLSAVVINSCIHLKDLTWLMYAANLESLSVESSPKMTELINKEKAQGVGVDPFQELQVLRLHYLKELGSIYGSQVSFPKLKLNKVDIENCPNLHQRP

HMMPanther: PTHR23155:SF116
12-842 PTHR23155:SF116,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

YKSALSYLCVKVGNICMLKENLVLLKSAFDELKAEKEDVVNRVNAGELKGGQRLAIVATWLSQVEIIEENTKQLMDVASARDASSQNASAVRRRLSTSGCWFSTCNLGEKVFKKLTEVKSLSGKDFQEVTEQPPPPVVEVRLCQQTVGLDTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDADVGKIQDAIGERLHICDNNWSTYSRGKKASEISRVLRDMKPRFVLLLDDLWEDVSLTAIGIPVLGKKYKVVFTTRSKDVCSVMRANEDIEVQCLSENDAWDLFDMKVHCDGLNEISDIAKKIVAKCCGLPLALEVIRKTMASKSTVIQWRRALDTLESYRSEMKGTEKGIFQVLKLSYDYLKTKNAKCFLYCALFPKAYYIKQDELVEYWIGEGFIDEKDGRERAKDRGYEIIDNLVGAGLLLESNKKVYMHDMIRDMALWIVSEFRDGERYVVKTDAGLSQLPDVTDWTTVTKMSLFNNEIKNIPDDPEFPDQTNLVTLFLQNNRLVDIVGKFFLVMSTLVVLDLSWNFQITELPKGISALVSLRLLNLSGTSIKHLPEGLGVLSKLIHLNLESTSNLRSVGLISELQKLQVLRFYGSAAALDCCLLKILEQLKGLQLLTVTVNNDSVLEEFLGSTRLAGMTQGIYLEGLKVSFAAIGTLSSLHKLEMVNCDITESGTEWEGKRRDQYSPSTSSSEITPSNPWFKDLSAVVINSCIHLKDLTWLMYAANLESLSVESSPKMTELINKEKAQGVGVDPFQELQVLRLHYLKELGSIYGSQVSFPKLKLNKVDIENCPNLHQRP

superfamily: SSF52540
137-381 SSF52540

FQEVTEQPPPPVVEVRLCQQTVGLDTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDADVGKIQDAIGERLHICDNNWSTYSRGKKASEISRVLRDMKPRFVLLLDDLWEDVSLTAIGIPVLGKKYKVVFTTRSKDVCSVMRANEDIEVQCLSENDAWDLFDMKVHCDGLNEISDIAKKIVAKCCGLPLALEVIRKTMASKSTVIQWRRALDTLESYRSE

HMMPfam: PF00931
IPR002182
161-439 NB-ARC,NBS
NB-ARC

DTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDADVGKIQDAIGERLHICDNNWSTYSRGKKASEISRVLRDMKPRFVLLLDDLWEDVSLTAIGIPVLGKKYKVVFTTRSKDVCSVMRANEDIEVQCLSENDAWDLFDMKVHCDGLNEISDIAKKIVAKCCGLPLALEVIRKTMASKSTVIQWRRALDTLESYRSEMKGTEKGIFQVLKLSYDYLKTKNAKCFLYCALFPKAYYIKQDELVEYWIGEGFIDEKD

Gene3D: G3DSA:3.40.50.300
171-297 G3DSA:3.40.50.300

LRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDADVGKIQDAIGERLHICDNNWSTYSRGKKASEISRVLRDMKPRFVLLLDDLWEDVSLTAIGIPVLGKKYKVVFTTRSKD

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

MLGIFGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

RDMKPRFVLLLDDLW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CCGLPLALEVIRKTM

superfamily: SSF52058
469-842 SSF52058,LRR

YMHDMIRDMALWIVSEFRDGERYVVKTDAGLSQLPDVTDWTTVTKMSLFNNEIKNIPDDPEFPDQTNLVTLFLQNNRLVDIVGKFFLVMSTLVVLDLSWNFQITELPKGISALVSLRLLNLSGTSIKHLPEGLGVLSKLIHLNLESTSNLRSVGLISELQKLQVLRFYGSAAALDCCLLKILEQLKGLQLLTVTVNNDSVLEEFLGSTRLAGMTQGIYLEGLKVSFAAIGTLSSLHKLEMVNCDITESGTEWEGKRRDQYSPSTSSSEITPSNPWFKDLSAVVINSCIHLKDLTWLMYAANLESLSVESSPKMTELINKEKAQGVGVDPFQELQVLRLHYLKELGSIYGSQVSFPKLKLNKVDIENCPNLHQRP

Gene3D: G3DSA:3.80.10.10
496-836 G3DSA:3.80.10.10

DAGLSQLPDVTDWTTVTKMSLFNNEIKNIPDDPEFPDQTNLVTLFLQNNRLVDIVGKFFLVMSTLVVLDLSWNFQITELPKGISALVSLRLLNLSGTSIKHLPEGLGVLSKLIHLNLESTSNLRSVGLISELQKLQVLRFYGSAAALDCCLLKILEQLKGLQLLTVTVNNDSVLEEFLGSTRLAGMTQGIYLEGLKVSFAAIGTLSSLHKLEMVNCDITESGTEWEGKRRDQYSPSTSSSEITPSNPWFKDLSAVVINSCIHLKDLTWLMYAANLESLSVESSPKMTELINKEKAQGVGVDPFQELQVLRLHYLKELGSIYGSQVSFPKLKLNKVDIENCP

ProfileScan: PS51450
IPR001611
510-531 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TVTKMSLFNNEIKNIPDDPEFP

HMMPfam: PF13855
534-594 LRR_8,Leucine rich repeat

TNLVTLFLQNNRLVDIVGKFFLVMSTLVVLDLSWNFQITELPKGISALVSLRLLNLSGTSI

ProfileScan: PS51450
IPR001611
535-556 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVTLFLQNNRLVDIVGKFFLV

ProfileScan: PS51450
IPR001611
559-581 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLVVLDLSWNFQITELPKGISAL

ProfileScan: PS51450
IPR001611
583-604 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRLLNLSGTSIKHLPEGLGVL

FPrintScan: PR00364
IPR000767
602-618 DISEASERSIST
Disease resistance protein

GVLSKLIHLNLESTSNL

ProfileScan: PS51450
IPR001611
606-628 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLIHLNLESTSNLRSVGLISELQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox