PRGDB00046993 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18418394 (NM_121774)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G17680) mRNA, complete cds.

DNA Sequence

ATGGCTTCTCTTCCTTCTTCTTCTTCTTCTTCTTCTTCAACAGTGTGGAAAACGGACGTTTTCGTGAGTTTTAGAGGAGAAGATGTGCGTAAAACATTCGTGAGCCATCTATTCTGCGAGTTTGATCGGATGGGGATTAAAGCTTTCAGAGACGATTTGGATCTACAGAGAGGAAAATCCATCTCCCCTGAGCTTATAGATGCGATCAAAGGCTCCAGATTTGCCATTGTTGTGGTCTCTAGGAACTACGCAGCTTCAAGCTGGTGCTTAGACGAGCTCTTGAAGATCATGGAATGTAATAAAGATACGATTGTACCCATTTTCTACGAGGTTGATCCTTCGGATGTGAGAAGACAGAGAGGAAGTTTCGGTGAAGATGTTGAGAGTCACAGTGACAAGGAGAAAGTGGGGAAATGGAAAGAAGCTTTGAAGAAATTAGCTGCCATTTCTGGTGAAGATTCTCGGAATTGGGATGACTCAAAGCTGATTAAGAAGATTGTTAAAGACATTTCTGATAAATTGGTTTCTACTTCATGGGATGATTCAAAAGGTTTGATTGGAATGAGTTCTCATATGGACTTTCTGCAGTCTATGATATCTATAGTGGACAAGGATGTTCGAATGTTGGGGATTTGGGGAATGGGTGGAGTTGGGAAAACTACGATTGCCAAATACTTATACAATCAACTCTCAGGTCAATTTCAAGTTCATTGCTTCATGGAGAATGTGAAGGAAGTCTGTAACAGATATGGAGTTAGGCGTTTACAAGTGGAGTTTTTATGCAGAATGTTTCAAGAGAGAGACAAAGAAGCGTGGAGTTCGGTTTCTTGTTGCAATATAATAAAGGAAAGGTTCAGGCACAAAATGGTTTTCATTGTTCTTGACGATGTAGATAGATCTGAGCAACTGAATGAATTGGTGAAGGAGACTGGTTGGTTTGGTCCGGGAAGCAGAATCATCGTGACAACACGGGATAGACATTTGCTACTTTCCCATGGAATAAATTTGGTGTATAAAGTGAAGTGTTTACCCAAAAAAGAAGCTCTCCAGCTCTTTTGTAATTATGCTTTCAGAGAAGAGATTATACTTCCACATGGGTTTGAGGAGTTATCGGTTCAAGCTGTTAACTATGCTTCTGGTCTTCCACTGGCTCTAAGAGTTTTAGGCTCCTTCCTTTATCGAAGAAGCCAAATTGAATGGGAAAGTACTCTTGCTAGGCTTAAAACTTACCCTCATAGTGATATCATGGAAGTTTTGAGAGTTAGCTACGACGGATTGGATGAGCAAGAGAAGGCTATTTTTCTCTATATATCATGTTTTTATAACATGAAGCAGGTTGATTATGTCAGAAAACTTCTGGATCTTTGTGGCTATGCTGCTGAAATCGGAATAACGATACTTACCGAGAAGTCTTTGATAGTTGAATCAAATGGATGCGTAAAGATACATGATTTGCTTGAACAGATGGGTAGAGAGCTTGTTCGTCAACAAGCAGTTAACAACCCAGCCCAACGGTTACTATTATGGGATCCTGAAGACATATGTCATTTGCTGTCAGAAAATTCTGGAACACAACTTGTTGAAGGAATCTCTCTGAACCTCTCTGAAATTTCTGAGGTATTTGCTAGTGATCGAGCGTTCGAGGGATTGTCTAATCTCAAACTTCTCAACTTCTATGATCTTTCGTTTGATGGAGAGACTAGAGTGCATCTACCTAATGGCCTCAGTTATCTCCCACGCAAGCTTCGTTATCTCCGTTGGGATGGATACCCTTTAAAGACTATGCCTTCAAGATTTTTTCCTGAGTTTCTTGTTGAACTTTGTATGAGTAATAGCAATCTTGAAAAACTTTGGGATGGGATCCAGCCTCTGAGGAACTTGAAGAAGATGGATCTTTCTCGCTGTAAATACCTTGTCGAAGTTCCAGACCTCTCAAAAGCCACAAATCTGGAGGAACTAAACCTTTCCTATTGCCAAAGCTTGGTTGAGGTTACTCCATCTATCAAGAACCTAAAGGGACTTTCTTGCTTCTACTTGACTAATTGCATCCAACTCAAGGACATTCCGATTGGAATAATTTTGAAGTCGCTTGAAACAGTGGGAATGAGTGGATGCTCAAGCCTAAAGCATTTTCCAGAAATTTCTTGGAATACTAGAAGACTCTATCTGAGCAGTACAAAGATAGAGGAACTTCCATCATCAATCAGCCGTCTCTCTTGTCTGGTTAAATTGGATATGTCAGATTGTCAGAGACTCAGGACTCTTCCAAGCTATCTAGGGCACTTGGTCTCACTGAAATCCCTGAATTTGGACGGTTGCAGACGTCTTGAGAACCTCCCAGACACGTTACAGAATCTAACATCTCTTGAAACGCTTGAAGTGTCTGGTTGCCTTAATGTCAACGAGTTCCCTCGTGTTTCCACGAGTATAGAAGTTCTGCGTATATCTGAGACATCAATTGAAGAAATTCCTGCAAGGATCTGTAATCTCTCTCAGCTTAGGTCCTTGGATATCTCAGAAAACAAAAGACTTGCATCACTTCCGGTAAGCATTTCTGAGCTAAGATCACTTGAAAAGCTCAAGCTTTCTGGATGTTCTGTACTCGAGAGTTTTCCACTAGAAATTTGTCAGACAATGAGCTGCTTGAGGTGGTTTGATTTAGATAGGACTAGCATTAAAGAACTACCTGAAAACATTGGGAATTTAGTAGCTCTTGAGGTGCTTCAAGCCAGTAGAACAGTGATAAGGCGAGCACCATGGTCTATTGCACGACTTACCCGTCTTCAAGTTTTAGCGATTGGGAATAGTTTCTTTACTCCAGAAGGTTTGTTGCATTCTCTTTGTCCTCCCTTATCAAGGTTTGATGACTTGAGAGCTCTGAGCCTAAGCAACATGAACATGACAGAGATTCCTAACAGTATTGGTAACTTATGGAATCTACTAGAACTAGATTTGAGTGGGAACAATTTTGAATTCATCCCCGCAAGCATCAAACGGCTCACCAGGTTGAACAGACTGAATTTAAACAATTGCCAGAGACTTCAAGCATTGCCCGATGAGCTTCCACGAGGTCTCTTGTATATCTACATCCATAGCTGCACATCACTAGTGAGTATCTCAGGTTGCTTCAACCAATATTGTCTGCGAAAGCTTGTAGCTAGCAACTGTTACAAATTGGATCAAGCAGCGCAGATTCTCATTCACCGTAACTTGAAGCTAGAGTCAGCAAAACCAGAACACTCTTATTTTCCTGGAAGTGACATACCCACTTGCTTCAATCACCAAGTCATGGGTCCTTCGCTGAATATACAGTTACCTCAGAGTGAATCATCGTCTGACATTCTGGGATTTTCTGCCTGCATCATGATTGGAGTTGATGGACAGTACCCGATGAACAATCTGAAGATACACTGCTCTTGTATATTAAAAGATGCTGATGCTTGTGAGCTGGTTGTTATGGATGAGGTGTGGTATCCTGATCCAAAAGCTTTCACAAACATGTATTTTGGATCAGATCACCTTCTCTTATTCAGCAGAACCTGCACGTCCATGGAAGCTTACAGCGAAGCCCTGTTTGAATTCTCAGTCGAAAACACAGAAGGAGATTCCTTTAGCCCGCTTGGAGAGGTTAAAAAATGTGCGGTACACCTTATATCACTCAAAGACATGATGCAAGAGTTCTCTAATGACTCTGACAAAATTCAGAGTTCTGATTTGGATCTTCCAAAGGCATTTGATGACGCAAGAATTTTGAAAAGAAGAGCATATGAAACTGAGTTCTTGCATAAGGAACAACTAAATCCCAAGAGGATCAAGTTTCTTCCAGTTCCTTTGGCTCGAGAGCGTCATTCCAAATTACATCAGCGAAATGTCATACGAAAGTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASLPSSSSSSSSTVWKTDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALKKLAAISGEDSRNWDDSKLIKKIVKDISDKLVSTSWDDSKGLIGMSSHMDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSGQFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFIVLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEALQLFCNYAFREEIILPHGFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLIVESNGCVKIHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVFASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSIKNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFPEISWNTRRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPRVSTSIEVLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSISGCFNQYCLRKLVASNCYKLDQAAQILIHRNLKLESAKPEHSYFPGSDIPTCFNHQVMGPSLNIQLPQSESSSDILGFSACIMIGVDGQYPMNNLKIHCSCILKDADACELVVMDEVWYPDPKAFTNMYFGSDHLLLFSRTCTSMEAYSEALFEFSVENTEGDSFSPLGEVKKCAVHLISLKDMMQEFSNDSDKIQSSDLDLPKAFDDARILKRRAYETEFLHKEQLNPKRIKFLPVPLARERHSKLHQRNVIRK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
6-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSSSSTVWKTDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALKKLAAISGE

ProfileScan: PS50104
IPR000157
16-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKTDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALKKLAAISGEDSRNW

HMMSmart: SM00255
IPR000157
17-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KTDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALKKLAAI

Gene3D: G3DSA:3.40.50.10140
18-147 G3DSA:3.40.50.10140

TDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALKKLA

HMMPfam: PF01582
IPR000157
20-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALK

HMMPanther: PTHR23155:SF252
29-1077 PTHR23155:SF252,SUBFAMILY NOT NAMED

VRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALKKLAAISGEDSRNWDDSKLIKKIVKDISDKLVSTSWDDSKGLIGMSSHMDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSGQFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFIVLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEALQLFCNYAFREEIILPHGFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLIVESNGCVKIHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVFASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSIKNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFPEISWNTRRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPRVSTSIEVLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSISGCFNQYCLRKLVASNCYKLDQAAQILIHRNLKLESAK

HMMPanther: PTHR23155
29-1077 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKDTIVPIFYEVDPSDVRRQRGSFGEDVESHSDKEKVGKWKEALKKLAAISGEDSRNWDDSKLIKKIVKDISDKLVSTSWDDSKGLIGMSSHMDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSGQFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFIVLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEALQLFCNYAFREEIILPHGFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLIVESNGCVKIHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVFASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSIKNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFPEISWNTRRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPRVSTSIEVLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSISGCFNQYCLRKLVASNCYKLDQAAQILIHRNLKLESAK

superfamily: SSF52540
168-415 SSF52540

KDISDKLVSTSWDDSKGLIGMSSHMDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSGQFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFIVLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEALQLFCNYAFREEIILPHGFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPHSDI

HMMPfam: PF00931
IPR002182
191-447 NB-ARC,NBS
NB-ARC

HMDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSGQFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFIVLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEALQLFCNYAFREEIILPHGFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVD

Gene3D: G3DSA:3.40.50.300
192-309 G3DSA:3.40.50.300

MDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSGQFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFIVLDDVDRSEQLNELVKE

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

MLGIWGMGGVGKTTIA

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

RFRHKMVFIVLDDVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

ASGLPLALRVLGSFL

superfamily: SSF46785
413-519 SSF46785

SDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLIVESNGCVKIHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLS

superfamily: SSF52058
514-874 SSF52058,LRR

ICHLLSENSGTQLVEGISLNLSEISEVFASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSIKNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFPEISWNTRRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPRVSTSIEVLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLE

Gene3D: G3DSA:3.80.10.10
526-792 G3DSA:3.80.10.10

LVEGISLNLSEISEVFASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSIKNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFPEISWNTRRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETL

HMMPfam: PF07725
IPR011713
603-622 LRR_3
Leucine-rich repeat 3

FLVELCMSNSNLEKLWDGIQ

FPrintScan: PR00364
IPR000767
622-638 DISEASERSIST
Disease resistance protein

QPLRNLKKMDLSRCKYL

HMMPfam: PF00560
IPR001611
649-671 LRR_1
Leucine-rich repeat

NLEELNLSYCQSLVEVTPSIKNL

HMMPfam: PF00560
IPR001611
764-786 LRR_1
Leucine-rich repeat

SLKSLNLDGCRRLENLPDTLQNL

Gene3D: G3DSA:3.80.10.10
793-1051 G3DSA:3.80.10.10

EVSGCLNVNEFPRVSTSIEVLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSISGCFNQYCLRKL

superfamily: SSF52047
808-1068 SSF52047,LRR

TSIEVLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSISGCFNQYCLRKLVASNCYKLDQAAQILIH

HMMPfam: PF13504
856-872 LRR_7,Leucine rich repeat

SLEKLKLSGCSVLESFP

HMMPfam: PF13855
957-1011 LRR_8,Leucine rich repeat

LRALSLSNMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox