PRGDB00046994 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422039 (NM_123456)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G40910) mRNA, complete cds.

DNA Sequence

ATGGCTTTTTCATCACCGTCTGACTTCAAGAGATACCATGTCTTTTCGAGTTTCCATGGACCAGATGTCCGTAGTGGATTTCTCAGTCATTTACACAATCACTTCGAAAGCAAAGGGATCACTCCGTTCAAGGATCAAGAGATCGAGAGAGGCCATACGATCGGACCTGAGCTCATACAAGCGATTAGAGAATCTAGAGTCTCGATTGTGGTGCTTTCAGAGAAGTACGCTTCTTCGTGCTGGTGCTTAGATGAGTTGGTGGAAATCTTGAAGTGCAAAGAAGCTTCGGGGCAAGTTGTGATGACTATTTTTTACAAAGTTGATCCGTCCGATGTACGGAAACAGCGGGGAGACTTCGGAAGTACTTTCAAGAAAACATGTGAAGGGAAAACCTGGATAGTGAAGCAGAGATGGATCAAAGCTTTGGAATATATAGCAACCGTAGCTGGAGAACACTCTCTAAGCTGGGCTAATGAAGCAGAGTTGATCCAAAAGATTGCTACAGATGTTTCAAACAAACTTAATCTTACACCGTCGAGGGATTTTGAGGGGATGGTGGGACTTGAAGCTCATTTGACAAAACTGGACTCTTTTTTATGCCTTGAGAGTGATGATGTAAAGATGATTGGCATTTGGGGTCCTGCTGGAATTGGTAAGACTACCATTGCTAGAGCTTTATTTAACCAACTCTCTACCGGTTTTCGGCTTAGTTGTTTTATGGGGACCATTGATGTTAATGACTATGATTCGAAGTTGTGTTTGCAAAACAAGCTTCTGTCCAAAATTTTGAACCAAAAGGATATGAAGATACATCATTTAGGCGCAATTGAAGAATGGCTACATAACCAAAGAGTTCTTATAGTTCTTGATGATGTGGATGATCTAGAGCAACTAGAGGTATTGGCTAAAGAAAGTTCTTGGTTCGGTCATGGAAGTCGGATCATTGTTTCCTTAAATGATAGAAAGATTTTGAAGGCACATGGGATCAACGATATCTACGATGTGGATTTTCCATCCGAAGAAGAAGCTCTTGAGATCTTATGTCTATCTGCTTTCAAACAAAATTCTCCACAAGATGGTTTTGAAGAGGTTGCAAAAAGAGTAGTAGAGCTTTGCGGTAAGCTTCCATTGGGCCTTCGTGTTGTGGGTTCTTCTTTTTATGGGGAGAGCGAGGATGAGTGGAGAATTCAATTATATGGAATTGAAACTAATCTTGATAGGAAAATTGAGAATGTCTTGAGAGTGGGATATGACAAATTGTCGGAGCGACATCAATCTTTGTTTCTTCATATTGCATGCTTTTTCAACCATAAAAGTGTTGATTATGTGACAACCATGCTCGCTGACAGTACTTTGGATGTCGAAAATGGGTTAAAGACCTTAGCCGCTAAATCTCTTGTGTCTACTAATGGATGGATAACGATGCACTGTCTACTACAACAATTGGGTAGACAAGTTGTTGTTCAACAGGGTGACCCGGGGAAACGTCAGTTTTTAGTAGAGGCCAAAGAGATTCGCGATGTCTTGGCAAATGAAACAGGTACTGAATCCGTCATAGGTATATCGTTTGACATTTCGAAGATCGAGACGTTATCTATAAGCAAGCGAGCCTTTAATAGAATGCGTAATCTCAAATTCTTAAATTTCTATAATGGAAGTGTTAGCTTGTTAGAGGACATGGAATATCTACCTCGTCTAAGGTTACTTTATTGGGGTTCATACCCGAGAAAAAGTCTTCCTCTGACATTTAAGCCAGAATGTCTCGTCGAACTCTATATGGGATTCAGCAAGTTGGAGAAGCTATGGGGAGGAATCCAGCCCCTCACAAATCTAAAGAAAATAAATTTGGGATATTCCTCTAATTTGAAAGAAATCCCAAATCTTTCGAAAGCCACTAACCTCAAGACGTTGACGCTTACCGGTTGTGAGAGTTTGGTGGAGATTCCATCCTCTATTTGGAATCTACAGAAACTGGAAATGCTGTATGCGTCAGGATGCATTAAGCTACAAGTTATTCCCACCAACATCAACTTAGCATCTCTTGAGGAAGTCAACATGAGTAATTGCTCACGTCTGAGAAGTTTTCCAGATATATCTAGTAACATTAAGCGTCTCTATGTAGCAGGCACAATGATTAAAGAATTTCCTGCATCCATTGTTGGACACTGGTGTCGTCTTGATTTTCTTCAGATAGGCAGCAGAAGCCTCAAGAGATTAACACATGTCCCAGAGAGTGTAACACATCTAGACCTACGCAACAGTGATATAAAGATGATCCCAGATTGCGTCATAGGTCTTCCGCATCTAGTATCTCTTCTCGTCGAAAACTGCACAAAACTGGTGTCAATTCAGGGTCATTCCCCTTCGCTGGTGACCCTATTTGCAGACCACTGTATATCACTCAAGAGCGTATGCTGCTCTTTCCACGGACCAATCTCGAAATTGATGTTCTACAACTGTCTGAAACTGGATAAGGAATCAAAAAGAGGAATCATACAACAATCGGGTAACAAGTCTATATGCTTGCCAGGTAAAGAAATCCCTGCAGAGTTCACTCACCAAACTATAGGGAACTTGATAACCATCTCCCTGGCTCCAGGTTGTGAGGAGGCTTATTCTACGTTCTCAAGATTTAAGGCTTGCCTCCTGCTTTCGCCAATCAAGAATTTCGCATTTAATAAGATAAATTGTTTTCTAAGAAGCAAAGGTGTCGAAATTAGTCGCACTACAGAGTCTATATATCCTTTTGTGTCTGGTGGATCTCTATCAGAACATCTGTTTATCTTTTGTGGCGACTTATTTCCTGAAGAAAACAGAAGCCTTATGGACGTGACTCCGAACGAGATTCTGTTTGATTTCAGCTCCAGTGATGTCGAGATTGTGGAATGTGGTGTAAAGATCTTTTTAAGTAGTGGCATTGAAGTGGGCTACTGTGAAACTGGAGGCAACAGAAACCACCACATAGATGGAGAAGCAGAAGCGTTTAAGGTAACTCAAGTTGAAAACAGTAAACATACAGGCCACTGGAGTTGGCTTAGGAAGCTTCGTCTGGGGAAGAAGAAGATGAAGAATAATAAGACAGAGCTTAGTTCGAGACCAGTCTCAGGATTTAGTGATCTTACTCGGGGAATCTTTATAAGGTATCAGGAGCCTGAAGCTGTTGAGCTCACTAAAGATGAAAGAATCACAGATCTTTCGAGTTTACTATGTATTGGTTCCCTTGTGGTCTGTTTTTTTCTTTCTGTTTTTTTCGGGCAACCCCTTGTGGTCTCTGTTTTGTTGCTTTTTTCTTGCTTCTTTCTTCAGATGCAATGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MAFSSPSDFKRYHVFSSFHGPDVRSGFLSHLHNHFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEGKTWIVKQRWIKALEYIATVAGEHSLSWANEAELIQKIATDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLANETGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCEEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLFIFCGDLFPEENRSLMDVTPNEILFDFSSSDVEIVECGVKIFLSSGIEVGYCETGGNRNHHIDGEAEAFKVTQVENSKHTGHWSWLRKLRLGKKKMKNNKTELSSRPVSGFSDLTRGIFIRYQEPEAVELTKDERITDLSSLLCIGSLVVCFFLSVFFGQPLVVSVLLLFSCFFLQMQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSPSDFKRYHVFSSFHGPDVRSGFLSHLHNHFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEGKTWIVKQRWIKALEYIATVAGE

Gene3D: G3DSA:3.40.50.10140
10-129 G3DSA:3.40.50.10140

KRYHVFSSFHGPDVRSGFLSHLHNHFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEG

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KRYHVFSSFHGPDVRSGFLSHLHNHFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEGKTWIVKQRWIKALEYIATV

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYHVFSSFHGPDVRSGFLSHLHNHFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEGKTWIVKQRWIKALEYIATV

HMMPfam: PF01582
IPR000157
14-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFSSFHGPDVRSGFLSHLHNHFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEGKTWIVKQRWIKAL

HMMPanther: PTHR11017:SF20
34-968 PTHR11017:SF20,SUBFAMILY NOT NAMED

HFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEGKTWIVKQRWIKALEYIATVAGEHSLSWANEAELIQKIATDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLANETGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCEEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLFIFCGDLFPEENRSLMDVTPNEILFDFSSSDVEIVECGVKIF

HMMPanther: PTHR11017
34-968 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HFESKGITPFKDQEIERGHTIGPELIQAIRESRVSIVVLSEKYASSCWCLDELVEILKCKEASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCEGKTWIVKQRWIKALEYIATVAGEHSLSWANEAELIQKIATDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLANETGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCEEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLFIFCGDLFPEENRSLMDVTPNEILFDFSSSDVEIVECGVKIF

superfamily: SSF52540
168-409 SSF52540

TDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKI

Gene3D: G3DSA:3.40.50.300
180-222 G3DSA:3.40.50.300

RDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTI

HMMPfam: PF00931
IPR002182
189-441 NB-ARC,NBS
NB-ARC

EAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVD

HMMSmart: SM00382
IPR003593
205-338 AAA,NBS
AAA+ ATPase domain

DVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFP

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

MIGIWGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
223-296 G3DSA:3.40.50.300

ARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLE

FPrintScan: PR00364
IPR000767
279-293 DISEASERSIST
Disease resistance protein

WLHNQRVLIVLDDVD

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CGKLPLGLRVVGSSF

superfamily: SSF46785
407-510 SSF46785

RKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLA

superfamily: SSF52058
500-823 SSF52058,LRR

VEAKEIRDVLANETGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKL

Gene3D: G3DSA:3.80.10.10
524-798 G3DSA:3.80.10.10

DISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHC

HMMPfam: PF07725
IPR011713
587-606 LRR_3
Leucine-rich repeat 3

CLVELYMGFSKLEKLWGGIQ

HMMPfam: PF00560
IPR001611
633-655 LRR_1
Leucine-rich repeat

NLKTLTLTGCESLVEIPSSIWNL

FPrintScan: PR00364
IPR000767
676-692 DISEASERSIST
Disease resistance protein

INLASLEEVNMSNCSRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox