PRGDB00046995 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18413118 (NM_116914)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G08450) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTCATAACTGGGTTTACGACGTTTTCACAAGCTTCAGCGGGGAAGATATCCGTGTAACTTTCCTCACCCACTTTCTCAAGGAGCTTGATCGAAAAATGATTATTGCTTTCAAAGACAATGAGATTGAGAGAGGGAACTCGATCGGTACCGAGCTTATACAGGCGATAAAGGATTCGAGGATCGCGGTGGTTGTGTTCTCCAAAAAATACTCTTCTTCGAGTTGGTGTTTGAATGAGTTGGTAGAGATTGTGAATTGCAAGGAAATTGTGATACCAGTTTTCTATGATTTAGATCCTTCTGATGTTAGGAAACAAGAGGGAGAATTTGGAGAGTCTTTTAAAGAGACTTGCAAGAACAGAACAGATTATGAGATACAACGTTGGGGCCAAGCGTTGACCAATGTAGCAAATATTGCTGGATATCACACTAGGAAACCGAATAACGAAGCAAAATTGATTGAAGAAATCACTAATGATGTTTTGGATAAACTAATGAAGTTAACACCATCGAAAGATTTTGATGAATTTTTTGGCATCGAAGATCATATCAAAGAGCTGAGTTTATTATTGTGCTTGGAATCTGAGGAAGTGAGAATGGTTGGGATATGGGGTCCTACGGGGATTGGTAAGACAACCATTGCAAGAGCTTTATTTAATCGAATCTACCGTCACTTCCAAGGTAGGGTTTTTATAGACAGAGCTTTTATATCTAAGAGTATGGCTATTTATAGTAGAGCAAACTCGGACGACTATAACTTGAAGTTGCATTTGCAAGAAAAGTTGTTGTCTAAACTTTTAGACAAAAAAAACTTGGAGATAAATCACCTAGATGCTGTGAAAGAGAGGCTAAGGCAAATGAAAGTTCTTATCTTTATTGATGATTTGGATGATCAAGTGGTGCTAGAAGCCTTAGCCTGTCAAACTCAGTGGTTTGGGCATGGAAGTAGAATCATTGTGATTACAAAAGATAAGCATCTCTTAAGGGCTTATGGGATTGATCATATATATGAGGTTCTTCTCCCGTCGAAAGACCTTGCTATTAAGATGTTTTGTCGATCTGCTTTTAGGAAAGACTCTCCACCCAATGGTTTTATAGAACTTGCTTATGATGTTGTAAAACGTGCAGGTAGTCTTCCTTTGGGTCTTAACATTTTAGGTTCGTATTTACGGGGTAGGAGTAAGGAGGATTGGATAGATATGATGCCGGGGCTTCGTAATAAACTAGACGGGAAAATTCAGAAAACACTTAGAGTCAGCTACGACGGGTTGGCTAGCGAAGACGATCAAGCGATATTTCGTCATATTGCATGTATTTTTAATTTTGAGGCATGCAGTGACATCAAGAAACTGCTTGAAGATAGTGGCTTGAATGTCACTAATGGGCTTATAAACCTTGTCGATAAGTCCCTCATACGTATAGAACCAAAGCAGAAAACTGTGGAGATGCATTGTTTGTTACAAGAAACGGCTAGAGAAATTATTCGTGCACAGTCTTTTGATGATCCTGGAAAACGAGAATTCCTTGTGGATGGGAAGGATATTGCTGATGTCCTAGATAATTGCAGTGGTACAAGAAAAGTCTTAGGTATATCATTGGATATGGATGAGATTGAAGAGTTGCATCTACAAGTAGACGCCTTCAAAAAGATGCTTAATCTCCGTTTTCTAAAACTTTACACAAATACAAATATATCAGAAAAAGAAGACAAATTGCTCTTACCTAAAGAATTCAACTATTTACCCAATACACTCAGATTACTAAGTTGGCAAAGGTTTCCAATGAGATGTATGCCTTCTGATTTTTTTCCTAAATATCTTGTTAAACTTCTAATGCCGGGGAGCAAGCTCGAGAAGCTGTGGGACGGAGTAATGCCGCTTCAATGCCTCAAGAATATGAATTTGTTTGGATCTGAAAACCTTAAAGAATTCCCAAATCTCTCGCTAGCAACAAACCTAGAGACATTGTCTCTTGGCTTTTGCTTGAGTTTGGTTGAGGTTCCTTCCACTATTGGGAATCTCAATAAACTTACGTATTTGAACATGTCAGGATGCCATAATTTGGAGAAATTTCCGGCTGATGTCAACCTCAAATCTCTCTCTGACCTCGTTCTCAATGGATGCTCACGTTTGAAGATTTTTCCCGCTATATCAAGCAACATCTCAGAGCTATGCCTAAACAGTTTAGCAGTTGAGGAATTCCCATCCAACTTGCATCTAGAGAATCTTGTTTATCTTTTAATTTGGGGAATGACGAGTGTCAAGTTGTGGGATGGCGTGAAGGTGCTTACATCCCTTAAAACTATGCATTTGCGAGATTCTAAAAACCTGAAAGAAATCCCAGATCTTTCAATGGCATCGAATCTTCTGATACTAAATCTTGAACAATGCATAAGTATTGTGGAGCTTCCTTCCTCTATTAGAAATCTCCATAACTTGATAGAGTTGGACATGTCAGGATGCACAAACCTGGAGACTTTTCCAACTGGCATCAACCTTCAATCTCTAAAACGCATAAATCTAGCTAGATGCTCACGGTTAAAGATTTTTCCGGATATCTCAACCAACATCTCAGAGCTTGATCTAAGCCAAACAGCGATTGAAGAAGTTCCTTTGTGGATCGAGAACTTCTCTAAGCTCAAATACTTAATAATGGGAAAATGTAACATGTTGGAATATGTATTCCTAAACATTTCCAAACTGAAACATCTCAAGAGCGTTGACTTTTCAGACTGTGGGATATTGTCTAAAGCAGACATGTACATGCTACAAGTACCCAATGAAGCTTCCTCTTCACTTCCAATTAATTGTGTCCAAAAAGCTGAGCTTATATTCATCAACTGCTACAAGCTGAATCAAAAAGCTCTCATTCGCCAACAATTTTTTCTGAAGAAAATGATTTTGCCAGGTGAAGAAGTGCCTTTTTATTTCACTCACCAAACAATAGGAAGCTCTATTGGTATCCCTCTACTTCACATATTACTTTCTCAACAATACTTCAGATTTAAGGCTTGTGTTGTGGTTGATCCCAAGTTTGTGTTCCCAGCTCGTCGTTATCACGTAAACATCCAGGTTTCTTGTCGATTCAAAGGCATATATGGGAACTACTTTGATTATGCTGATCAGCCACATTGCTTCTCACCATCTCAGACGGACAATTATGTGTATGTATTTGATTGTTGTTTCCCTCTTAACAAAGACAATGCTCCTCTAGCTGAACTCGACTATGATCATGTGGATATAGAATTTCATCTTGATGATAACTACAATCACCACAAAATAAAAGGATGCGGTATACGACTCTCTGAGGATGATGAAAGCAGTGACGATGATGATGACCTAAGCAGTGAAACTGATTATAGTGATGAGTGTGAAGATAGCGATGATAGTGATCTTGGAAATGAAATTGATTACAGTGAAGACTATGAAGACCGCGATACTAGTGATCTTGGAAATGAAACTGATTACAGTGAAGAGTATGAAGACCATGATAGTAGTGATCTTGGCAATGAGTATGACTATAATGAAGAGTGTGAAGAAAATGATGATAATGATCTTGTACTTGAGACTGATCACAATGAAGAGTGTCAAGACAACGATGTGGAGAAGAAGAGAAGTAGTAAGCGAATGCGGGTAAATTTTTATATAGTTCACAATTCTTTTCCAAGATCAAACGTAAACTTTTTCATATAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSHNWVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGYHTRKPNNEAKLIEEITNDVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILSKADMYMLQVPNEASSSLPINCVQKAELIFINCYKLNQKALIRQQFFLKKMILPGEEVPFYFTHQTIGSSIGIPLLHILLSQQYFRFKACVVVDPKFVFPARRYHVNIQVSCRFKGIYGNYFDYADQPHCFSPSQTDNYVYVFDCCFPLNKDNAPLAELDYDHVDIEFHLDDNYNHHKIKGCGIRLSEDDESSDDDDDLSSETDYSDECEDSDDSDLGNEIDYSEDYEDRDTSDLGNETDYSEEYEDHDSSDLGNEYDYNEECEENDDNDLVLETDHNEECQDNDVEKKRSSKRMRVNFYIVHNSFPRSNVNFFI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSHNWVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGY

Gene3D: G3DSA:3.40.50.10140
7-142 G3DSA:3.40.50.10140

HNWVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVAN

ProfileScan: PS50104
IPR000157
9-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANI

HMMSmart: SM00255
IPR000157
10-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANI

HMMPfam: PF01582
IPR000157
13-138 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALT

HMMPanther: PTHR11017:SF20
30-1188 PTHR11017:SF20,SUBFAMILY NOT NAMED

FLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGYHTRKPNNEAKLIEEITNDVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILSKADMYMLQVPNEASSSLPINCVQKAELIFINCYKLNQKALIRQQFFLKKMILPGEEVPFYFTHQTIGSSIGIPLLHILLSQQYFRFKACVVVDPKFVFPARRYHVNIQVSCRFKGIYGNYFDYADQPHCFSPSQTDNYVYVFDCCFPLNKDNAPLAELDYDHVDIEFHLDDNYNHHKIKGCGIRLSEDDESSDDDDDLSSETDYSDECEDSDDSDLGNEIDYSEDYEDRDTSDLGNETDYSEEYEDHDSSDLGNEYDYNEECEENDDN

HMMPanther: PTHR11017
30-1188 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGYHTRKPNNEAKLIEEITNDVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILSKADMYMLQVPNEASSSLPINCVQKAELIFINCYKLNQKALIRQQFFLKKMILPGEEVPFYFTHQTIGSSIGIPLLHILLSQQYFRFKACVVVDPKFVFPARRYHVNIQVSCRFKGIYGNYFDYADQPHCFSPSQTDNYVYVFDCCFPLNKDNAPLAELDYDHVDIEFHLDDNYNHHKIKGCGIRLSEDDESSDDDDDLSSETDYSDECEDSDDSDLGNEIDYSEDYEDRDTSDLGNETDYSEEYEDHDSSDLGNEYDYNEECEENDDN

superfamily: SSF52540
164-417 SSF52540

DVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKI

Gene3D: G3DSA:3.40.50.300
170-335 G3DSA:3.40.50.300

MKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAY

HMMPfam: PF00931
IPR002182
185-443 NB-ARC,NBS
NB-ARC

EDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACI

HMMSmart: SM00382
IPR003593
201-347 AAA,NBS
AAA+ ATPase domain

EVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPS

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

MVGIWGPTGIGKTTIA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

RLRQMKVLIFIDDLD

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AGSLPLGLNILGSYL

superfamily: SSF46785
415-524 SSF46785

GKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLD

superfamily: SSF52058
486-919 SSF52058,LRR

EMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGIL

Gene3D: G3DSA:3.80.10.10
537-750 G3DSA:3.80.10.10

LDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYL

HMMPfam: PF07725
IPR011713
610-628 LRR_3
Leucine-rich repeat 3

YLVKLLMPGSKLEKLWDGV

HMMPfam: PF00560
IPR001611
680-698 LRR_1
Leucine-rich repeat

KLTYLNMSGCHNLEKFPAD

Gene3D: G3DSA:3.80.10.10
759-920 G3DSA:3.80.10.10

KLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILS

FPrintScan: PR00364
IPR000767
812-828 DISEASERSIST
Disease resistance protein

RNLHNLIELDMSGCTNL

HMMPfam: PF00560
IPR001611
816-833 LRR_1
Leucine-rich repeat

NLIELDMSGCTNLETFPT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox