PRGDB00046996 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30681992 (NM_117271)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT4G12010) mRNA, complete cds.

DNA Sequence

ATGGAATCATCTTCTCCATCTTCAGCAGAGTTCGATGTGTTTCTCAGTTTCAGAGGCTTTGACACACGCAACAACTTCACCGGTCATCTCCAAAAAGCACTTCGTCTAAGAGGAATCGACTCATTCATCGACGACAGACTCCGTCGAGGAGACAATCTCACTGCGCTTTTCGATAGAATCGAGAAATCCAAGATTGCAATCATCGTCTTCTCCACGAACTATGCAAATTCTGCGTGGTGTCTTCGAGAGTTAGTGAAGATCCTCGAATGTAGGAACAGCAACCAACAGCTAGTGGTACCAATCTTCTACAAAGTTGACAAATCGGACGTCGAGAAACAGAGGAATAGTTTTGCGGTGCCGTTCAAGTTACCAGAATTGACTTTTCCCGGAGTTACGCCGGAAGAAATTTCATCGTGGAAGGCTGCTCTTGCCTCAGCATCCAACATCCTAGGTTATGTAGTCAAGGAAATTAGCACGTCTGAGGCCAAACTTGTTGATGAAATAGCCGTTGACACATTCAAGAAGTTGAATGATTTGGCTCCAAGCGGGAACGAAGGTCTCGTGGGGATAGAATCGCGTCTGAAGAATCTTGAAAAGTTGTTATCATGGGAGGATTTGGATACCGTTCATATCATAGGCATTGTTGGAATGGTTGGGATTGGGAAAACGACTCTTGCTGATTGTTTGTATGGACGTATGCGTGGTCAGTTCGACGGTAGCTGCTTCCTTACTAATATCCGCGAAAATTCAGGTAGAAGCGGGTTAGAATCTTTGCTGCAGAAACTCTTTTCCACTGTACTTAATGATAGAGATTTGGAGATTGGAGCTCCTGGAAATGCACATGAGAGATTTGAGCGGCGGCTTAAGAGCAAGAGGCTACTTATTGTGCTTGATGATGTGAATGATGAAAAGCAAATCAGATATCTTATGGGGCATTGCAAATGGTATCAAGGAGGAAGTAGAATTATCATTACTACTAGAGATAGTAAACTGATTGAGACGATCAAAGGCCGAAAATACGTGCTCCCGAAATTGAATGATAGAGAAGCCTTGAAGCTCTTTAGCTTGAATGCTTTTAGTAACTCTTTCCCTTTGAAAGAGTTCGAAGGTTTGACAAATATGGTTCTTGATTACGCTAAAGGCCACCCTTTGGCTCTTAAGGTGTTAGGATCTGATCTTTGTGAGAGGGATGATCTGTACTGGGAAGCTAAACTGGATAGACTGAAAAGTAGATCACATGGAGATATCTACGAAGTTCTAGAAACAAGCTATGAGGAGCTTACCACTGAACAGAAGAATGTTTTTCTGGATATTGCATGTTTCTTCAGATCAGAGAATGTGGATTACGTGACAAGCCTTCTCAACAGTCATGGTGTGGACGTCTCTGGCGTGGTAAAGGATCTCGTTGACAAATGTCTGATCACTCTTTCTGATAATCGCATCGAGATGCATGACATGTTGCAAACGATGGCCAAGGAGATTAGTTTAAAAGTAGAAACAATAGGTATAAGAGACTGTAGGTGGCTATCACGACATGGTAACCAGTGCCAATGGCATATCAGATTATGGGACAGTGAAGATATTTGTGACCTGCTAACCGAAGGCCTGGGAACTGATAAGATAAGAGGCATTTTTCTCGACACATCAAAACTAAGAGCAATGCGTCTAAGTGCCAAAGCCTTCCAAGGGATGTACAATCTCAAATACTTGAAAATTTATGATTCTCATTGTTCCCGTGGATGCGAAGCAGAGTTTAAACTACACTTGCGGAGGGGACTTAGTTTCCTTCCTAACGAGCTTACATATCTACACTGGCATGGTTATCCACTACAGAGTATCCCTCTAGACTTTGACCCTAAGAATCTTGTAGACCTTAAATTGCCACATAGTCAATTAGAAGAAATTTGGGATGATGAAAAGGATGTTGGAATGCTCAAATGGGTCGACCTTAGTCATTCTATAAATTTACGTCAGTGTTTGGGTTTGGCTAATGCTCATAATCTTGAGAGGTTGAATCTAGAAGGATGTACAAGTTTGAAAAAATTGCCGTCAACGATAAATTGTTTGGAGAAGCTTATATACCTCAATCTCAGGGATTGCACAAGCCTTAGGAGTCTTCCAAAAGGAATCAAAACTCAATCCTTGCAAACTCTTATTCTCAGTGGCTGCTCCAGCTTAAAGAAATTCCCACTGATCTCGGAAAATGTTGAAGTTCTACTTTTAGATGGCACTGTTATAAAGAGCCTTCCCGAATCCATTCAAACCTTTAGAAGACTTGCTTTGCTGAATCTGAAGAACTGCAAAAAGCTGAAGCATCTTTCTTCTGATCTTTATAAGCTGAAATGTCTTCAAGAGCTAATACTCTCAGGTTGCTCACAACTAGAGGTTTTTCCAGAAATTAAGGAAGACATGGAATCTTTGGAGATTTTACTTATGGATGATACATCCATCACAGAGATGCCAAAGATGATGCATTTGAGCAATATCAAGACATTTTCGTTATGTGGTACAAGCAGTCACGTTTCTGTTAGTATGTTCTTCATGCCACCTACATTGGGCTGCTCTCGGTTAACAGATCTTTACCTCTCAAGATGCAGTCTCTACAAACTCCCAGATAATATCGGTGGCCTATCCTCTTTGCAGTCTTTATGCTTAAGCGGAAACAACATCGAGAATCTTCCAGAAAGCTTCAACCAACTTAACAATCTGAAATGGTTTGATCTTAAGTTTTGCAAAATGCTCAAGTCTCTACCAGTCCTTCCACAAAACCTGCAGTATCTGGATGCACACGAATGCGAGTCACTTGAAACTTTGGCAAATCCATTGACGCCTTTGACAGTAGGAGAGAGAATCCATTCTATGTTCATCTTTAGCAACTGTTACAAACTGAACCAAGACGCACAAGCGAGTCTCGTGGGTCATGCTCGAATCAAAAGTCAGTTAATGGCTAATGCTTCTGCAAAACGTTATTATCGGGGATTTGTTCCGGAGCCTCTGGTTGGTATCTGTTACCCGGCCACTGAAATACCGAGTTGGTTCTGCCACCAAAGACTAGGACGTTCACTAGAAATCCCATTGCCTCCGCACTGGTGTGATATTAACTTTGTTGGACTTGCGTTATCTGTAGTTGTCTCATTCAAGGACTATGAAGACAGTGCGAAACGTTTCTCGGTAAAGTGTTGTGGCAACTTCGAGAACAAAGACAGTTCCTTCACGAGATTTGATTTCACTCTCGCAGGCTGGAACGAACCATGTGGATCCCTTAGCCATGAATCAAGAAAGCTCACTTCTGACCACGTTTTCATGGGATACAACAGTTGTTTTCTCGTCAAAAATGTCCATGGAGAGAGTAACAGCTGTTGCTACACAAAGGCTTCGTTCGAATTCTATGTGACAGATGATGAAACAAGGAAGAAGATAGAAACTTGTGAAGTGATAAAATGTGGGATGAGTTTAATGTATGTTCCTGAAGATGATGATTGTATGTTGCTAAAGAAGACAAATATAGTTCAGCTGAGTTTGAAGAGCGGACCAAGTTGTTCCTACGATCTTGATGATGTTATGGATGACGTTAGACCCAAGAGAGGACTTTGCCAGTTTGTTGGTGGTGAAGAACCAGGTTGTAAGAGAAGGAAGGAGGAGAAGATCACAGTGAGATAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MESSSPSSAEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLNDLAPSGNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMSLMYVPEDDDCMLLKKTNIVQLSLKSGPSCSYDLDDVMDDVRPKRGLCQFVGGEEPGCKRRKEEKITVR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MESSSPSSAEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGY

Gene3D: G3DSA:3.40.50.10140
8-144 G3DSA:3.40.50.10140

SAEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALA

ProfileScan: PS50104
IPR000157
9-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AEFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNI

HMMSmart: SM00255
IPR000157
10-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EFDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNI

HMMPfam: PF01582
IPR000157
13-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAAL

HMMPanther: PTHR11017
37-1160 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLNDLAPSGNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMSLMYVPEDDD

HMMPanther: PTHR11017:SF20
37-1160 PTHR11017:SF20,SUBFAMILY NOT NAMED

RGIDSFIDDRLRRGDNLTALFDRIEKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVPFKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLNDLAPSGNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMSLMYVPEDDD

superfamily: SSF52540
185-416 SSF52540

EGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDI

Gene3D: G3DSA:3.40.50.300
187-335 G3DSA:3.40.50.300

LVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETI

HMMPfam: PF00931
IPR002182
195-447 NB-ARC,NBS
NB-ARC

KNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFDGSCFLTNIRENSGRSGLESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVLDDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIETIKGRKYVLPKLNDREALKLFSLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRLKSRSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENV

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

IIGIVGMVGIGKTTLA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

RLKSKRLLIVLDDVN

FPrintScan: PR00364
IPR000767
379-393 DISEASERSIST
Disease resistance protein

AKGHPLALKVLGSDL

superfamily: SSF46785
414-533 SSF46785

GDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVDKCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLT

superfamily: SSF52058
482-933 SSF52058,LRR

EMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICDLLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECE

Gene3D: G3DSA:3.80.10.10
546-834 G3DSA:3.80.10.10

LDTSKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKKFPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMHLSNIKTFSL

HMMPfam: PF07725
IPR011713
621-640 LRR_3
Leucine-rich repeat 3

NLVDLKLPHSQLEEIWDDEK

ProfileScan: PS51450
IPR001611
621-642 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVDLKLPHSQLEEIWDDEKDV

ProfileScan: PS51450
IPR001611
667-689 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLERLNLEGCTSLKKLPSTINCL

FPrintScan: PR00364
IPR000767
710-726 DISEASERSIST
Disease resistance protein

IKTQSLQTLILSGCSSL

ProfileScan: PS51450
IPR001611
806-827 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEILLMDDTSITEMPKMMHLS

Gene3D: G3DSA:3.80.10.10
848-944 G3DSA:3.80.10.10

MPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTP

HMMPfam: PF13855
855-912 LRR_8,Leucine rich repeat

SRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCK

ProfileScan: PS51450
IPR001611
856-877 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTDLYLSRCSLYKLPDNIGGL

ProfileScan: PS51450
IPR001611
879-900 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQSLCLSGNNIENLPESFNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox