PRGDB00046997 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18404548 (NM_113447)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT3G25510) mRNA, complete cds.

DNA Sequence

ATGAATTCTTCTTTTTTCCTTGGTACTCTTGCAGCTGCAATAGGCTTCTTAACCCTTTTAAAAAAATTCAAATTCCAACAAGATAACAGAGAAGATGATTCTGCTTCTTTGTCCCCTTCATCAGTTCCTCCATCTTCTTTGTCTCGAACTTGGAAGCACCAAGTCTTCCCGAGCTTCCATGGGGCAGATGTTCGAAAAACCTTTCTTAGTCACGTCCTAGAGGCGTTCAGAGGAAAGGGAATTGACCCATTTATTGATAATAGTATCGAGAGGAGTAAGTCAATCGGTCCTGAGCTCGTAGAAGCTATCAGAGGATCAAGGATTGCGATTGTCTTGCTCTCGAGGAACTATGCTTCTTCGTCGTGGTGCATGAACGAGTTGGTGGAGATTATGAAGTGCAAGGAAGACTTGGGTCAAATAGTGATAACCATTTTCTATGAAGTTGATCCAACTCATATAAAGAAACAGACCGGAGATTTTGGGAAGGTTTTCAAAGAAACTTGCAAAGGTAAAACAAAGGAAGAGATAAAGAGATGGAGAAAAGCTTTGGAGGGTGTGGCCACAATCGCTGGTTACCATTCAAGCAACTGGGATTTCGAAGCATTGATTGGAATGGGAGCTCATATGGAAAATATGCGAGCATTGTTACGCCTAGATTTAGATGACGTGAGGATGATTGGGATATGGGGTCCGCCTGGGATTGGTAAGACCACTATCGCTAGGTTTCTGTTAAGCCAAGTCTCCAAGAGTTTCCAACTGAGCACAATCATGGTGAATATCAAAGAATGTTATCCAAGTCCTTGTCTTGATGAATATAGTGTACAGTTGCAACTTCAAAACAAAATGTTGTCTAAGATGATCAACCAGAAAGACATCATGATTCCTCATTTAGGAGTAGCACAAGAACGGTTGAAAGACAAGAAGGTGTTTCTAGTACTTGATGATGTGGATCAGTTAGGACAACTAGATGCATTGGCGAAAGAAACTAGATGGTTTGGTCCTGGAAGTCGGATTATCATCACAACAGAAAATCTAAGACTTTTGATGGCTCATAGGATCAACCATATTTACAAAGTAGAATTTTCATCAACTGATGAGGCTTTTCAAATCTTCTGTATGCATGCCTTTGGTCAAAAGCATCCCTATAATGGTTTCTATGAGCTTTCTCGGGAAGTTACTGAGCTTGCTGGTGGGCTCCCTTTGGGATTGAAGGTCATGGGCTCGTCCTTACGAGGAATGTCCAAGCAGGAGTGGAAAAGGACACTACCAAGGTTAAGGACATGCCTTGATGGAAAAATTGAGAGCATTTTAATGTTTAGCTACGAGGCCTTAAGTCATGAAGACAAAGATTTGTTTCTTTGTATAGCTTGCTTTTTCAACTATCAAAAGATTAAGAAGGTGGAAAAACATCTTGCTGATAGGTTCTTGGATGTGAGGCAAGGGCTTTATGTCTTAGCCGAAAAATCTCTCATACATATAGGCACGGGAGCGACAGAGATGCATACTTTGCTAGTGCAACTAGGTAGAGAAATAGCTCATACACAATCAACTAATGACCCTAGAAAATCTCTTTTTTTGGTTGATGAAAGAGAGATTTGTGAGGCCCTCAGTGATGAGACAATGGATAGTAGTCGACGTATTATAGGGATGGATTTTGACTTATCTAAGAATGGGGAGGAAGTTACAAACATAAGTGAGAAAGGTCTTCAAAGAATGTCTAATCTCCAATTCATAAGATTTGATGGTAGAAGTTGTGCTCGACATTCTTCGAATCTCACAGTAGTAAGATCTTCTGATAATAATTGTGCTCATCCCGACACAGTGAATGCACTACAAGATCTGAACTATCAATTTCAAGAAATTAGATTACTGCATTGGATAAATTTTAGGAGATTATGCTTGCCTTCTACTTTTAATCCGGAGTTTCTTGTTGAACTTAACATGCCTTCTAGCACGTGTCATACACTCTGGGAAGGAAGCAAAGCGCTTAGAAATCTCAAGTGGATGGATTTGAGTTATTCTATAAGCCTGAAGGAGCTTCCTGATCTTTCAACTGCCACTAATCTTGAAGAGTTAATTCTTAAATATTGCGTAAGTTTAGTGAAGGTCCCATCATGTGTTGGAAAACTTGGCAAACTACAAGTTTTGTGTCTCCATGGATGTACAAGTATCTTGGAGCTCCCCTCCTTCACCAAAAATGTCACTGGCCTCCAGAGTTTAGATCTCAATGAGTGCTCAAGTTTGGTGGAGCTCCCTTCTTCGATTGGGAATGCCATAAATCTCCAAAATTTGGATCTTGGATGTTTAAGGCTGCTTAAGCTTCCTTTGTCTATTGTGAAGTTCACTAATCTCAAGAAATTTATCCTCAATGGATGCTCAAGTCTAGTGGAGCTTCCCTTTATGGGAAATGCCACAAATCTCCAAAATCTTGATCTTGGTAATTGTTCTAGTTTGGTGGAGCTCCCATCTTCTATAGGAAATGCCATTAATCTTCAAAATCTTGATCTTAGTAATTGTTCAAGTCTGGTGAAGCTTCCTTCCTTTATCGGAAATGCCACTAATCTCGAGATTTTAGACCTCCGTAAATGCTCAAGTCTAGTGGAGATCCCTACTTCTATTGGACATGTCACTAATCTGTGGAGATTAGATCTTAGCGGATGCTCAAGTTTAGTGGAACTTCCCTCATCTGTTGGAAACATCAGTGAACTCCAAGTGTTGAATCTCCATAACTGCTCAAATCTGGTGAAGCTTCCCTCTTCTTTTGGACATGCCACTAATCTGTGGAGATTAGATCTTAGCGGATGCTCAAGTTTAGTGGAACTTCCCTCATCTATTGGAAACATCACAAATCTCCAAGAGCTGAACCTTTGCAACTGCTCAAATCTGGTGAAGCTTCCCTCTTCTATTGGAAACCTTCATCTATTGTTCACTTTGAGTTTGGCAAGATGCCAAAAGTTAGAGGCTCTTCCGAGCAATATCAACTTGAAATCTCTTGAACGACTTGATCTCACCGATTGCTCGCAGTTTAAAAGTTTTCCTGAGATTTCCACAAACATTGAATGCCTCTATCTTGATGGAACCGCAGTAGAAGAAGTGCCTTCATCAATCAAGTCTTGGTCTAGACTCACTGTGTTGCATATGTCATACTTCGAAAAACTCAAGGAATTCTCGCATGTTCTAGACATCATAACGTGGCTAGAATTCGGAGAAGATATACAAGAAGTTGCTCCATGGATCAAAGAAATCTCTCGTCTACATGGACTTAGACTCTACAAATGCAGAAAGCTTTTATCACTCCCACAGCTTCCAGAATCTCTCTCTATCATAAATGCTGAAGGTTGTGAGTCCTTGGAGACACTAGATTGCTCTTACAACAATCCCTTGAGTCTTCTTAATTTTGCTAAGTGCTTCAAACTGAATCAAGAAGCGAGAGACTTCATCATCCAGATACCGACCAGTAATGATGCGGTCTTACCCGGTGCAGAAGTGCCTGCATACTTCACTCACCGAGCTACTACTGGAGCTTCCTTGACCATCAAGTTAAATGAGAGGCCTATTTCTACATCCATGAGATTTAAGGCTTGTATCGTACTGATTAAGTGTGACAATGATGAAGCTGGTGATGATGGGAGTTCGTTGATGGTACATGTTGACATCATGGACAAACAAAATGGTCTCAGTGTTCCGTATAGTCCAGGAATCTATACTATATATCCACTTTTAACAGAGCACCTGTACATATTTCAAGGTGAAGCAGAGGAGTCCCTTCAAGTTGATGCTTATGATGATAGCTTCAACGAGGCGTTGATGAAGGAGTTTCAAAGAAAAGGAATCACACCTTTCAATGATAATGAGATCAAGAGAGGAGAATCCATTAGTCCTGAACTTGTACTAGCAATCAGAGGTTCTAGGATTGCACTCATCTTACTCTCTAGGAACTACGCTTCTTCGTCTTGGTGTCTTGATGAATTAGCGGAGATAATCAAGTGTAGAGAAGAGTTTGGTCAAACTGTGATGGTTGTTTTCTATAAAGTTGATCCTTCTGATATAAAGAAGTTGACTGGTGACTTTGGGAGTGTTTTCAGAAAAACATGTGCTGGTAAAACAAATGAGGACACTAGGAGATGGATACAAGCTCTAGCAAAAGTGGCAACACTTGCCGGTTACGTTTCAAACAACTGGGATAATGAGGCGGTCATGATTGAAAAAATCGCCACTGATATTTCAAACAAGTTGAATAAGTCCACACCATCTAGGGATTTCGACGAATTAGTTGGGATGGGAGCTCATATGGAAAGGATGGAACTATTGTTATGCCTAGACTCTGATGAAGTGAGGATGATAGGGATTTGGGGTCCGTCTGGGATTGGTAAGACCACCATTGCTAGATTCTTGTTTAGCCAGTTTTCTGATAGTTTCGAACTAAGCGCCTTTATGGAGAATATAAAAGAGCTAATGTATAGAAAACCAGTGTGTTCTGATGACTATAGTGCAAAGTTGCACTTACAAAACCAGTTTATGTCTCAAATAATCAACCATATGGATGTCGAGGTTCCTCATTTAGGAGTTGTAGAAAATAGGTTGAATGACAAAAAAGTACTTATTGTTCTAGATAACATCGATCAGTCAATGCAACTAGATGCTATCGCAAAAGAAACTCGGTGGTTCGGTCATGGAAGTCGGATTATCATCACAACACAAGACCAAAAACTTTTGAAGGCACATGGCATCAACCATATTTACAAGGTGGATTATCCGTCAACACATGAAGCTTGCCAAATCTTTTGTATGTCTGCTGTTGGTAAAAAGTTCCCTAAAGATGAGTTTCAAGAACTTGCATTGGAAGTCACAAATCTTTTAGGTAACCTACCATTGGGACTAAGAGTTATGGGCTCTCATTTTCGGGGAATGTCTAAGCAGGAGTGGATAAATGCACTACCAAGGTTAAGGACTCACCTTGATTCTAATATTCAAAGCATTTTAAAGTTCAGTTACGATGCCTTATGTCGTGAAGATAAAGATTTATTCCTTCACATAGCATGCACTTTCAACAATAAAAGGATTGAGAACGTGGAAGCGCATCTTACACATAAGTTCTTGGATACAAAACAACGATTTCACGTATTAGCAGAGAAATCTCTCATATCTATTGAAGAAGGATGGATAAAGATGCATAATCTGTTAGAACTGTTGGGTAGAGAAATTGTATGTCATGAGCATGAATCCATTCGAGAGCCTGGGAAGCGTCAATTTTTGGTTGATGCTAGAGATATTTGTGAAGTACTCACTGATGACACGGGTAGTAAAAGTGTTGTAGGTATATATTTCAATTCAGCTGAGCTATTAGGCGAATTAAATATAAGTGAAAGAGCTTTCGAAGGAATGTCTAATCTTAAATTCTTAAGAATCAAGTGTGACCGGAGTGATAAAATGTACTTACCGCGAGGTTTAAAGTATATATCTCGAAAACTTAGATTACTAGAATGGGATCGTTTTCCACTGACATGTTTGCCTTCCAATTTTTGTACGGAGTACCTTGTCGAACTAAACATGCGACACAGCAAACTTGTGAAGCTGTGGGAAGGAAATCTGTCGCTCGGAAACCTCAAGTGGATGAATTTGTTCCATTCGAAGAACTTAAAGGAGCTACCTGATTTCTCAACTGCCACTAACCTTCAAACATTGATTCTTTGTGGATGCTCAAGTTTGGTGGAGCTGCCTTACTCTATCGGCAGTGCCAATAATCTCCAGAAATTGCATCTTTGTAGGTGCACCAGTCTAGTGGAGCTGCCCGCTTCTATTGGAAACCTTCATAAATTGCAAAATGTGACCTTAAAAGGATGCTCAAAGCTAGAGGTTGTTCCTACCAACATCAACTTGATACTTGATGTTAAAAAGTATAAAAACAGAGAAAACAGGGGACTCTGTTCTAAAAAAGAAATATAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MNSSFFLGTLAAAIGFLTLLKKFKFQQDNREDDSASLSPSSVPPSSLSRTWKHQVFPSFHGADVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGVATIAGYHSSNWDFEALIGMGAHMENMRALLRLDLDDVRMIGIWGPPGIGKTTIARFLLSQVSKSFQLSTIMVNIKECYPSPCLDEYSVQLQLQNKMLSKMINQKDIMIPHLGVAQERLKDKKVFLVLDDVDQLGQLDALAKETRWFGPGSRIIITTENLRLLMAHRINHIYKVEFSSTDEAFQIFCMHAFGQKHPYNGFYELSREVTELAGGLPLGLKVMGSSLRGMSKQEWKRTLPRLRTCLDGKIESILMFSYEALSHEDKDLFLCIACFFNYQKIKKVEKHLADRFLDVRQGLYVLAEKSLIHIGTGATEMHTLLVQLGREIAHTQSTNDPRKSLFLVDEREICEALSDETMDSSRRIIGMDFDLSKNGEEVTNISEKGLQRMSNLQFIRFDGRSCARHSSNLTVVRSSDNNCAHPDTVNALQDLNYQFQEIRLLHWINFRRLCLPSTFNPEFLVELNMPSSTCHTLWEGSKALRNLKWMDLSYSISLKELPDLSTATNLEELILKYCVSLVKVPSCVGKLGKLQVLCLHGCTSILELPSFTKNVTGLQSLDLNECSSLVELPSSIGNAINLQNLDLGCLRLLKLPLSIVKFTNLKKFILNGCSSLVELPFMGNATNLQNLDLGNCSSLVELPSSIGNAINLQNLDLSNCSSLVKLPSFIGNATNLEILDLRKCSSLVEIPTSIGHVTNLWRLDLSGCSSLVELPSSVGNISELQVLNLHNCSNLVKLPSSFGHATNLWRLDLSGCSSLVELPSSIGNITNLQELNLCNCSNLVKLPSSIGNLHLLFTLSLARCQKLEALPSNINLKSLERLDLTDCSQFKSFPEISTNIECLYLDGTAVEEVPSSIKSWSRLTVLHMSYFEKLKEFSHVLDIITWLEFGEDIQEVAPWIKEISRLHGLRLYKCRKLLSLPQLPESLSIINAEGCESLETLDCSYNNPLSLLNFAKCFKLNQEARDFIIQIPTSNDAVLPGAEVPAYFTHRATTGASLTIKLNERPISTSMRFKACIVLIKCDNDEAGDDGSSLMVHVDIMDKQNGLSVPYSPGIYTIYPLLTEHLYIFQGEAEESLQVDAYDDSFNEALMKEFQRKGITPFNDNEIKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVATLAGYVSNNWDNEAVMIEKIATDISNKLNKSTPSRDFDELVGMGAHMERMELLLCLDSDEVRMIGIWGPSGIGKTTIARFLFSQFSDSFELSAFMENIKELMYRKPVCSDDYSAKLHLQNQFMSQIINHMDVEVPHLGVVENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVDYPSTHEACQIFCMSAVGKKFPKDEFQELALEVTNLLGNLPLGLRVMGSHFRGMSKQEWINALPRLRTHLDSNIQSILKFSYDALCREDKDLFLHIACTFNNKRIENVEAHLTHKFLDTKQRFHVLAEKSLISIEEGWIKMHNLLELLGREIVCHEHESIREPGKRQFLVDARDICEVLTDDTGSKSVVGIYFNSAELLGELNISERAFEGMSNLKFLRIKCDRSDKMYLPRGLKYISRKLRLLEWDRFPLTCLPSNFCTEYLVELNMRHSKLVKLWEGNLSLGNLKWMNLFHSKNLKELPDFSTATNLQTLILCGCSSLVELPYSIGSANNLQKLHLCRCTSLVELPASIGNLHKLQNVTLKGCSKLEVVPTNINLILDVKKYKNRENRGLCSKKEI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
41-192 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SVPPSSLSRTWKHQVFPSFHGADVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGVATIAGY

Gene3D: G3DSA:3.40.50.10140
49-186 G3DSA:3.40.50.10140

RTWKHQVFPSFHGADVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGV

ProfileScan: PS50104
IPR000157
51-189 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHQVFPSFHGADVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGVATI

HMMSmart: SM00255
IPR000157
52-189 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHQVFPSFHGADVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGVATI

HMMPfam: PF01582
IPR000157
55-183 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKAL

HMMPanther: PTHR23155
63-1948 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGVATIAGYHSSNWDFEALIGMGAHMENMRALLRLDLDDVRMIGIWGPPGIGKTTIARFLLSQVSKSFQLSTIMVNIKECYPSPCLDEYSVQLQLQNKMLSKMINQKDIMIPHLGVAQERLKDKKVFLVLDDVDQLGQLDALAKETRWFGPGSRIIITTENLRLLMAHRINHIYKVEFSSTDEAFQIFCMHAFGQKHPYNGFYELSREVTELAGGLPLGLKVMGSSLRGMSKQEWKRTLPRLRTCLDGKIESILMFSYEALSHEDKDLFLCIACFFNYQKIKKVEKHLADRFLDVRQGLYVLAEKSLIHIGTGATEMHTLLVQLGREIAHTQSTNDPRKSLFLVDEREICEALSDETMDSSRRIIGMDFDLSKNGEEVTNISEKGLQRMSNLQFIRFDGRSCARHSSNLTVVRSSDNNCAHPDTVNALQDLNYQFQEIRLLHWINFRRLCLPSTFNPEFLVELNMPSSTCHTLWEGSKALRNLKWMDLSYSISLKELPDLSTATNLEELILKYCVSLVKVPSCVGKLGKLQVLCLHGCTSILELPSFTKNVTGLQSLDLNECSSLVELPSSIGNAINLQNLDLGCLRLLKLPLSIVKFTNLKKFILNGCSSLVELPFMGNATNLQNLDLGNCSSLVELPSSIGNAINLQNLDLSNCSSLVKLPSFIGNATNLEILDLRKCSSLVEIPTSIGHVTNLWRLDLSGCSSLVELPSSVGNISELQVLNLHNCSNLVKLPSSFGHATNLWRLDLSGCSSLVELPSSIGNITNLQELNLCNCSNLVKLPSSIGNLHLLFTLSLARCQKLEALPSNINLKSLERLDLTDCSQFKSFPEISTNIECLYLDGTAVEEVPSSIKSWSRLTVLHMSYFEKLKEFSHVLDIITWLEFGEDIQEVAPWIKEISRLHGLRLYKCRKLLSLPQLPESLSIINAEGCESLETLDCSYNNPLSLLNFAKCFKLNQEARDFIIQIPTSNDAVLPGAEVPAYFTHRATTGASLTIKLNERPISTSMRFKACIVLIKCDNDEAGDDGSSLMVHVDIMDKQNGLSVPYSPGIYTIYPLLTEHLYIFQGEAEESLQVDAYDDSFNEALMKEFQRKGITPFNDNEIKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVATLAGYVSNNWDNEAVMIEKIATDISNKLNKSTPSRDFDELVGMGAHMERMELLLCLDSDEVRMIGIWGPSGIGKTTIARFLFSQFSDSFELSAFMENIKELMYRKPVCSDDYSAKLHLQNQFMSQIINHMDVEVPHLGVVENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVDYPSTHEACQIFCMSAVGKKFPKDEFQELALEVTNLLGNLPLGLRVMGSHFRGMSKQEWINALPRLRTHLDSNIQSILKFSYDALCREDKDLFLHIACTFNNKRIENVEAHLTHKFLDTKQRFHVLAEKSLISIEEGWIKMHNLLELLGREIVCHEHESIREPGKRQFLVDARDICEVLTDDTGSKSVVGIYFNSAELLGELNISERAFEGMSNLKFLRIKCDRSDKMYLPRGLKYISRKLRLLEWDRFPLTCLPSNFCTEYLVELNMRHSKLVKLWEGNLSLGNLKWMNLFHSKNLKELPDFSTATNLQTLILCGCSSLVELPYSIGSANNLQKLHLCRCTSLVELPASIGNLHKLQNVTLKGC

HMMPanther: PTHR23155:SF297
63-1948 PTHR23155:SF297

DVRKTFLSHVLEAFRGKGIDPFIDNSIERSKSIGPELVEAIRGSRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGVATIAGYHSSNWDFEALIGMGAHMENMRALLRLDLDDVRMIGIWGPPGIGKTTIARFLLSQVSKSFQLSTIMVNIKECYPSPCLDEYSVQLQLQNKMLSKMINQKDIMIPHLGVAQERLKDKKVFLVLDDVDQLGQLDALAKETRWFGPGSRIIITTENLRLLMAHRINHIYKVEFSSTDEAFQIFCMHAFGQKHPYNGFYELSREVTELAGGLPLGLKVMGSSLRGMSKQEWKRTLPRLRTCLDGKIESILMFSYEALSHEDKDLFLCIACFFNYQKIKKVEKHLADRFLDVRQGLYVLAEKSLIHIGTGATEMHTLLVQLGREIAHTQSTNDPRKSLFLVDEREICEALSDETMDSSRRIIGMDFDLSKNGEEVTNISEKGLQRMSNLQFIRFDGRSCARHSSNLTVVRSSDNNCAHPDTVNALQDLNYQFQEIRLLHWINFRRLCLPSTFNPEFLVELNMPSSTCHTLWEGSKALRNLKWMDLSYSISLKELPDLSTATNLEELILKYCVSLVKVPSCVGKLGKLQVLCLHGCTSILELPSFTKNVTGLQSLDLNECSSLVELPSSIGNAINLQNLDLGCLRLLKLPLSIVKFTNLKKFILNGCSSLVELPFMGNATNLQNLDLGNCSSLVELPSSIGNAINLQNLDLSNCSSLVKLPSFIGNATNLEILDLRKCSSLVEIPTSIGHVTNLWRLDLSGCSSLVELPSSVGNISELQVLNLHNCSNLVKLPSSFGHATNLWRLDLSGCSSLVELPSSIGNITNLQELNLCNCSNLVKLPSSIGNLHLLFTLSLARCQKLEALPSNINLKSLERLDLTDCSQFKSFPEISTNIECLYLDGTAVEEVPSSIKSWSRLTVLHMSYFEKLKEFSHVLDIITWLEFGEDIQEVAPWIKEISRLHGLRLYKCRKLLSLPQLPESLSIINAEGCESLETLDCSYNNPLSLLNFAKCFKLNQEARDFIIQIPTSNDAVLPGAEVPAYFTHRATTGASLTIKLNERPISTSMRFKACIVLIKCDNDEAGDDGSSLMVHVDIMDKQNGLSVPYSPGIYTIYPLLTEHLYIFQGEAEESLQVDAYDDSFNEALMKEFQRKGITPFNDNEIKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVATLAGYVSNNWDNEAVMIEKIATDISNKLNKSTPSRDFDELVGMGAHMERMELLLCLDSDEVRMIGIWGPSGIGKTTIARFLFSQFSDSFELSAFMENIKELMYRKPVCSDDYSAKLHLQNQFMSQIINHMDVEVPHLGVVENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVDYPSTHEACQIFCMSAVGKKFPKDEFQELALEVTNLLGNLPLGLRVMGSHFRGMSKQEWINALPRLRTHLDSNIQSILKFSYDALCREDKDLFLHIACTFNNKRIENVEAHLTHKFLDTKQRFHVLAEKSLISIEEGWIKMHNLLELLGREIVCHEHESIREPGKRQFLVDARDICEVLTDDTGSKSVVGIYFNSAELLGELNISERAFEGMSNLKFLRIKCDRSDKMYLPRGLKYISRKLRLLEWDRFPLTCLPSNFCTEYLVELNMRHSKLVKLWEGNLSLGNLKWMNLFHSKNLKELPDFSTATNLQTLILCGCSSLVELPYSIGSANNLQKLHLCRCTSLVELPASIGNLHKLQNVTLKGC

superfamily: SSF52540
106-453 SSF52540

SRIAIVLLSRNYASSSWCMNELVEIMKCKEDLGQIVITIFYEVDPTHIKKQTGDFGKVFKETCKGKTKEEIKRWRKALEGVATIAGYHSSNWDFEALIGMGAHMENMRALLRLDLDDVRMIGIWGPPGIGKTTIARFLLSQVSKSFQLSTIMVNIKECYPSPCLDEYSVQLQLQNKMLSKMINQKDIMIPHLGVAQERLKDKKVFLVLDDVDQLGQLDALAKETRWFGPGSRIIITTENLRLLMAHRINHIYKVEFSSTDEAFQIFCMHAFGQKHPYNGFYELSREVTELAGGLPLGLKVMGSSLRGMSKQEWKRTLPRLRTCLDGKIESILMFSYEALSHEDKDLFL

Gene3D: G3DSA:3.40.50.300
202-349 G3DSA:3.40.50.300

LIGMGAHMENMRALLRLDLDDVRMIGIWGPPGIGKTTIARFLLSQVSKSFQLSTIMVNIKECYPSPCLDEYSVQLQLQNKMLSKMINQKDIMIPHLGVAQERLKDKKVFLVLDDVDQLGQLDALAKETRWFGPGSRIIITTENLRLLM

HMMPfam: PF00931
IPR002182
211-467 NB-ARC,NBS
NB-ARC

NMRALLRLDLDDVRMIGIWGPPGIGKTTIARFLLSQVSKSFQLSTIMVNIKECYPSPCLDEYSVQLQLQNKMLSKMINQKDIMIPHLGVAQERLKDKKVFLVLDDVDQLGQLDALAKETRWFGPGSRIIITTENLRLLMAHRINHIYKVEFSSTDEAFQIFCMHAFGQKHPYNGFYELSREVTELAGGLPLGLKVMGSSLRGMSKQEWKRTLPRLRTCLDGKIESILMFSYEALSHEDKDLFLCIACFFNYQKIKKV

HMMSmart: SM00382
IPR003593
222-360 AAA,NBS
AAA+ ATPase domain

DVRMIGIWGPPGIGKTTIARFLLSQVSKSFQLSTIMVNIKECYPSPCLDEYSVQLQLQNKMLSKMINQKDIMIPHLGVAQERLKDKKVFLVLDDVDQLGQLDALAKETRWFGPGSRIIITTENLRLLMAHRINHIYKVE

FPrintScan: PR00364
IPR000767
225-240 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
303-317 DISEASERSIST
Disease resistance protein

RLKDKKVFLVLDDVD

FPrintScan: PR00364
IPR000767
396-410 DISEASERSIST
Disease resistance protein

AGGLPLGLKVMGSSL

superfamily: SSF52058
499-911 SSF52058,LRR

EMHTLLVQLGREIAHTQSTNDPRKSLFLVDEREICEALSDETMDSSRRIIGMDFDLSKNGEEVTNISEKGLQRMSNLQFIRFDGRSCARHSSNLTVVRSSDNNCAHPDTVNALQDLNYQFQEIRLLHWINFRRLCLPSTFNPEFLVELNMPSSTCHTLWEGSKALRNLKWMDLSYSISLKELPDLSTATNLEELILKYCVSLVKVPSCVGKLGKLQVLCLHGCTSILELPSFTKNVTGLQSLDLNECSSLVELPSSIGNAINLQNLDLGCLRLLKLPLSIVKFTNLKKFILNGCSSLVELPFMGNATNLQNLDLGNCSSLVELPSSIGNAINLQNLDLSNCSSLVKLPSFIGNATNLEILDLRKCSSLVEIPTSIGHVTNLWRLDLSGCSSLVELPSSVGNISELQVLNLHNC

Gene3D: G3DSA:3.80.10.10
635-712 G3DSA:3.80.10.10

PSTFNPEFLVELNMPSSTCHTLWEGSKALRNLKWMDLSYSISLKELPDLSTATNLEELILKYCVSLVKVPSCVGKLGK

HMMPfam: PF07725
IPR011713
642-661 LRR_3
Leucine-rich repeat 3

FLVELNMPSSTCHTLWEGSK

Gene3D: G3DSA:3.80.10.10
713-935 G3DSA:3.80.10.10

LQVLCLHGCTSILELPSFTKNVTGLQSLDLNECSSLVELPSSIGNAINLQNLDLGCLRLLKLPLSIVKFTNLKKFILNGCSSLVELPFMGNATNLQNLDLGNCSSLVELPSSIGNAINLQNLDLSNCSSLVKLPSFIGNATNLEILDLRKCSSLVEIPTSIGHVTNLWRLDLSGCSSLVELPSSVGNISELQVLNLHNCSNLVKLPSSFGHATNLWRLDLSGC

superfamily: SSF52047
805-1126 SSF52047,LRR

TNLQNLDLGNCSSLVELPSSIGNAINLQNLDLSNCSSLVKLPSFIGNATNLEILDLRKCSSLVEIPTSIGHVTNLWRLDLSGCSSLVELPSSVGNISELQVLNLHNCSNLVKLPSSFGHATNLWRLDLSGCSSLVELPSSIGNITNLQELNLCNCSNLVKLPSSIGNLHLLFTLSLARCQKLEALPSNINLKSLERLDLTDCSQFKSFPEISTNIECLYLDGTAVEEVPSSIKSWSRLTVLHMSYFEKLKEFSHVLDIITWLEFGEDIQEVAPWIKEISRLHGLRLYKCRKLLSLPQLPESLSIINAEGCESLETLDCSYNN

HMMPfam: PF00560
IPR001611
806-827 LRR_1
Leucine-rich repeat

NLQNLDLGNCSSLVELPSSIGN

HMMPfam: PF00560
IPR001611
830-848 LRR_1
Leucine-rich repeat

NLQNLDLSNCSSLVKLPSF

HMMPfam: PF00560
IPR001611
878-898 LRR_1
Leucine-rich repeat

NLWRLDLSGCSSLVELPSSVG

HMMPfam: PF00560
IPR001611
903-923 LRR_1
Leucine-rich repeat

LQVLNLHNCSNLVKLPSSFGH

HMMPfam: PF00560
IPR001611
926-947 LRR_1
Leucine-rich repeat

NLWRLDLSGCSSLVELPSSIGN

Gene3D: G3DSA:3.80.10.10
941-1126 G3DSA:3.80.10.10

LPSSIGNITNLQELNLCNCSNLVKLPSSIGNLHLLFTLSLARCQKLEALPSNINLKSLERLDLTDCSQFKSFPEISTNIECLYLDGTAVEEVPSSIKSWSRLTVLHMSYFEKLKEFSHVLDIITWLEFGEDIQEVAPWIKEISRLHGLRLYKCRKLLSLPQLPESLSIINAEGCESLETLDCSYNN

HMMPfam: PF00560
IPR001611
950-972 LRR_1
Leucine-rich repeat

NLQELNLCNCSNLVKLPSSIGNL

FPrintScan: PR00364
IPR000767
993-1009 DISEASERSIST
Disease resistance protein

INLKSLERLDLTDCSQF

HMMSmart: SM00255
IPR000157
1234-1386 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IYTIYPLLTEHLYIFQGEAEESLQVDAYDDSFNEALMKEFQRKGITPFNDNEIKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVATL

HMMPfam: PF01582
IPR000157
1260-1381 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AYDDSFNEALMKEFQRKGITPFNDNEIKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALA

Gene3D: G3DSA:3.40.50.10140
1263-1384 G3DSA:3.40.50.10140

DSFNEALMKEFQRKGITPFNDNEIKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVA

ProfileScan: PS50104
IPR000157
1267-1386 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EALMKEFQRKGITPFNDNEIKRGESISPELVLAIRGSRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVATL

superfamily: SSF52540
1303-1677 SSF52540

SRIALILLSRNYASSSWCLDELAEIIKCREEFGQTVMVVFYKVDPSDIKKLTGDFGSVFRKTCAGKTNEDTRRWIQALAKVATLAGYVSNNWDNEAVMIEKIATDISNKLNKSTPSRDFDELVGMGAHMERMELLLCLDSDEVRMIGIWGPSGIGKTTIARFLFSQFSDSFELSAFMENIKELMYRKPVCSDDYSAKLHLQNQFMSQIINHMDVEVPHLGVVENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVDYPSTHEACQIFCMSAVGKKFPKDEFQELALEVTNLLGNLPLGLRVMGSHFRGMSKQEWINALPRLRTHLDSNIQSILKFSYDALCREDKDLFL

Gene3D: G3DSA:3.40.50.300
1419-1457 G3DSA:3.40.50.300

RDFDELVGMGAHMERMELLLCLDSDEVRMIGIWGPSGIG

HMMPfam: PF00931
IPR002182
1430-1691 NB-ARC,NBS
NB-ARC

HMERMELLLCLDSDEVRMIGIWGPSGIGKTTIARFLFSQFSDSFELSAFMENIKELMYRKPVCSDDYSAKLHLQNQFMSQIINHMDVEVPHLGVVENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVDYPSTHEACQIFCMSAVGKKFPKDEFQELALEVTNLLGNLPLGLRVMGSHFRGMSKQEWINALPRLRTHLDSNIQSILKFSYDALCREDKDLFLHIACTFNNKRIENV

HMMSmart: SM00382
IPR003593
1444-1586 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGPSGIGKTTIARFLFSQFSDSFELSAFMENIKELMYRKPVCSDDYSAKLHLQNQFMSQIINHMDVEVPHLGVVENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVDYP

Gene3D: G3DSA:3.40.50.300
1458-1490 G3DSA:3.40.50.300

KTTIARFLFSQFSDSFELSAFMENIKELMYRKP

Gene3D: G3DSA:3.40.50.300
1522-1597 G3DSA:3.40.50.300

GVVENRLNDKKVLIVLDNIDQSMQLDAIAKETRWFGHGSRIIITTQDQKLLKAHGINHIYKVDYPSTHEACQIFCM

superfamily: SSF52058
1723-1955 SSF52058,LRR

KMHNLLELLGREIVCHEHESIREPGKRQFLVDARDICEVLTDDTGSKSVVGIYFNSAELLGELNISERAFEGMSNLKFLRIKCDRSDKMYLPRGLKYISRKLRLLEWDRFPLTCLPSNFCTEYLVELNMRHSKLVKLWEGNLSLGNLKWMNLFHSKNLKELPDFSTATNLQTLILCGCSSLVELPYSIGSANNLQKLHLCRCTSLVELPASIGNLHKLQNVTLKGCSKLEVVP

Gene3D: G3DSA:3.80.10.10
1786-1957 G3DSA:3.80.10.10

NISERAFEGMSNLKFLRIKCDRSDKMYLPRGLKYISRKLRLLEWDRFPLTCLPSNFCTEYLVELNMRHSKLVKLWEGNLSLGNLKWMNLFHSKNLKELPDFSTATNLQTLILCGCSSLVELPYSIGSANNLQKLHLCRCTSLVELPASIGNLHKLQNVTLKGCSKLEVVPTN

HMMPfam: PF07725
IPR011713
1845-1863 LRR_3
Leucine-rich repeat 3

YLVELNMRHSKLVKLWEGN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox