PRGDB00046998 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186510925 (NM_115015)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT3G51560) mRNA, complete cds.

DNA Sequence

ATGGTGGATTGCAGCGATGTTTACATCAGCTTCGACAGAAGTGAGGATACGGTGCGGTACTCTTTTGTCAGCCACCTCTGCGCCGCTTTCCGCCGCAGAGGAATATCTTCGTTCATCAGAGAAAACGGCTCCGATTCGGAAAGCAATGGATTCTCCAAGTTGGAGACGTCTAGGGCTTCTGTAGTGGTTTTCTCTGAGAAATACTCGTCATCCAAGTCATGCATGGAGGAGCTGGTCAAGGTTTCCGAACGCCGGCGGAAAAACTGTCTCGCGGTGGTTCCGGTATTTTACCCAGTCACGAAATCGTTTATGAAGAAACAAATCTGGAATTTGGGCGATGTTAGAAGCGATTGGCCAAGTGCTCTATTGGAAACTGTAGACTTACCAGGCCACGAGTTATACGATACGCAAAGTGACTCTGACTTTGTGGAGGAGATTGTGGCTGATGTGCGTGAAAAGCTCAACATGTCAGACAATATTGGAATCTACTCAAAGTTGGGGAAGATAGAAACATTGATTTACAAGCAACCGTGGGGTGTCCGCAGCATAGGAATATGGGGAATGCCCGGCATAGGCAAGACAACTCTTGCTAAAGCTGCTTTTGACCAACTCTCTGGTGACTATGAGGCTTCTTGTTTCATCAAAGACTTTAACAAGGCGTTTCATGAGAAGGGACTTTATGGTTTGTTAGAGGCACACTTTGGGAAAATTCTTAGGGAAGAGCTTGGCATAAAAAGTTCGATTACAAGACCGATCCTCCTTAGAAATGTTTTACGCCATAAAAGAGTTCTTGTCGTTCTTGATGATGTGTGTAAGCCTCTAGATGCAGAGTCCTTTCTTGGAGGGTTTGATTGGTTTTGTCCGGGAAGCTTGATCATCATAACTTCAAGAGATAAACAAGTATTTTCTATATGTCGGGTCGATCAGATATATGAGGTTCCAGGTTTAAATGAGGAAGAGGCTCTGCAGCTATTCTCGCGGTGTGCATTCGGAAAGGAGATTATACATGAGAGTTTGCAGAAACTATCAAAGAAAGTGATTGATTATGCTAATGGAAATCCTTTAGCTCTGATTTTTTTTGGATGTATGTCAAGGAAGAATCCTAAACCTATAGAGATTGCATTCCCCAAAGTCAAGAAATATCTGGCACATGAGATTCATGATGCAGTCAAGAGTACATATGATTCGCTTAGTTCCAACGAGAAGAACATATTTCTTGATATTGCGTGTCTTTTCAGAGGAGAAAATGTCGACTGTGTAATACATCTGCTTGAGGGATGTGGTTTCTTTCCACGTGTTGAAATCAATGTTCTTGTTGAGAAGTGTTTGGTGAGTATGGCAGAAGGCAGGGTTGTGATGCATAATTTGATCCAATCCATAGGTCGCAAAATTATCAATGGAGGAAAGAGGCGTTCCAGACTGTGGAAACCTTTGATAATTAAGTATTTTCTAGAAGATAGACAAGTTTTGGGTAGTGAAGATATTGAAGCCATATTTCTGGACCCATCTGCCTTAAGCTTTGATGTCAATCCTATGGCGTTTGAGAATATGTATAATCTTAGATATCTGAAGATTTGCAGTTCCAATCCTGGAAACCATTATGCTCTACACCTTCCCAAGGGCGTCAAATCCCTACCGGAGGAGTTAAGGTTACTGCACTGGGAACATTTTCCATTGTTATCCTTACCACAAGATTTTAACACTAGAAATCTTGTTATACTCAACATGTGTTACAGTAAACTTCAGAGACTTTGGGAAGGAACCAAGGAACTTGGGATGCTGAAGAGGATCATGCTTTGTCATTCACAACAGCTAGTTGGTATTCAAGAACTCCAAATTGCTCTAAATATGGAGGTAATTGATCTCCAAGGTTGTGCAAGACTACAAAGATTTCTAGCAACAGGTCATTTCCAGCATCTTCGGGTGATAAATCTCTCTGGTTGCATAAAGATCAAAAGTTTCCCAGAGGTTCCACCTAATATTGAGGAGCTGTATCTCAAACAAACTGGCATAAGATCAATACCAACTGTGACCTTCTCTCCACAAGATAACTCATTTATTTATGATCATAAAGATCACAAATTCTTGAATCGGGAGGTCTCGTCTGATTCGCAAAGTCTGTCAATCATGGTTTATCTAGACAACCTCAAAGTTCTTGATCTTTCTCAATGCTTAGAGCTTGAGGATATTCAGGGTATACCAAAAAACCTAAGAAAGTTATATCTTGGTGGTACAGCCATAAAAGAACTGCCTTCGCTCATGCATCTTTCTGAACTGGTTGTATTAGATTTGGAGAACTGCAAACGCCTTCACAAGTTACCAATGGGAATAGGTAACTTGAGTTCTCTTGCGGTGTTAAATCTCTCTGGATGCTCAGAACTTGAGGATATTCAAGGTATCCCAAGAAACTTGGAAGAGTTATATCTTGCTGGCACCGCTATACAGGAAGTGACATCGTTAATCAAGCATCTCTCAGAACTTGTAGTTTTAGATTTACAGAATTGCAAAAGGCTTCAACATCTTCCAATGGAGATTAGTAACTTAAAATCTCTTGTCACACTTAAGCTAACGGATCCATCTGGGATGTCCATAAGAGAAGTATCAACATCAATTATCCAGAATGGTATATCAGAAATTGGCATCAGTAATTTGAATTATCTTCTCTTGACTTTCAATGAGAATGCAGAGCAGCGTAGAGAATATTTGCCTCGACCAAGGCTGCCATCTTCAAGTTTACATGGCTTGGTCCCAAGATTTTATGCCCTAGTATCTTTATCCCTCTTCAATGCATCCTTGATGCATATACCGGAAGAGATTTGTTCCTTGCCTTCAGTAGTGCTGTTGGATCTTGGTCGGAATGGTTTCAGCAAAATCCCTGAAAGCATAAAGCAGTTATCTAAACTACATAGCCTTAGATTAAGACATTGTAGAAACCTCATATTGCTTCCGGCGCTTCCCCAAAGCCTGAAACTGTTGAACGTGCATGGTTGTGTGTCTCTAGAGTCAGTTTCTTGGGGATTTGAGCAGTTTCCTAGTCATTACACCTTCAGCGATTGCTTCAATAAGTCTCCAAAAGTGGCTAGAAAACGAGTTGTAAAAGGCCTGGCTAAAGTAGCAAGCATTGGCAACGAACATCAGCAGGAACTCATCAAAGCACTTGCATTCAGCATTTGCGGGCCTGCAGGAGCAGATCAGGCAACCTCTTATAATTTGCGGGCAGGTTCATTTGCAACGATAGAGATAACTCCTTCCCTGCGAAAGACACTCTTGGGGTTTGCTATCTTCGTTGTAGTATCGTTTTCGGATGATAGTCACAACAACGCTGGGCTTGGCGTTAGGTGCGTAAGCAGATGGAAGACAAAGAAAAGGGTGGTCACTGGTAAAGCAGAGAAAGTGTTTAGGTGTTGGGCTCCGAGAGAAGCTCCTGAGGTTCAAAGGGATCACATGTTTGTGTTTTATGAGGATGCCGAAATGCATCGAGGTGGTGGTGAGGGAAACAAACCAAATATAATGGCTGATCACGTTGAATTTGAATTCCAAGCAGTAAATGGAAGAAACAAGGTCTTAGGCGGTAATTGCATGGTGACAGAATGTGATGTTTGTGTTATAACAGCTGCAACTGGTGCGGCGAGTCTGAGTGTAACAAATGCAAGTAAGGATATGAGTTTAAGTAAGAATCATTCTCCGAAGCTTTCAAGTGTGATTGGTAAGCTTCGATTTAAGCGAGTTGGTAGGTTTGGTGGTTGTGTTTGCCTAGAGTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MVDCSDVYISFDRSEDTVRYSFVSHLCAAFRRRGISSFIRENGSDSESNGFSKLETSRASVVVFSEKYSSSKSCMEELVKVSERRRKNCLAVVPVFYPVTKSFMKKQIWNLGDVRSDWPSALLETVDLPGHELYDTQSDSDFVEEIVADVREKLNMSDNIGIYSKLGKIETLIYKQPWGVRSIGIWGMPGIGKTTLAKAAFDQLSGDYEASCFIKDFNKAFHEKGLYGLLEAHFGKILREELGIKSSITRPILLRNVLRHKRVLVVLDDVCKPLDAESFLGGFDWFCPGSLIIITSRDKQVFSICRVDQIYEVPGLNEEEALQLFSRCAFGKEIIHESLQKLSKKVIDYANGNPLALIFFGCMSRKNPKPIEIAFPKVKKYLAHEIHDAVKSTYDSLSSNEKNIFLDIACLFRGENVDCVIHLLEGCGFFPRVEINVLVEKCLVSMAEGRVVMHNLIQSIGRKIINGGKRRSRLWKPLIIKYFLEDRQVLGSEDIEAIFLDPSALSFDVNPMAFENMYNLRYLKICSSNPGNHYALHLPKGVKSLPEELRLLHWEHFPLLSLPQDFNTRNLVILNMCYSKLQRLWEGTKELGMLKRIMLCHSQQLVGIQELQIALNMEVIDLQGCARLQRFLATGHFQHLRVINLSGCIKIKSFPEVPPNIEELYLKQTGIRSIPTVTFSPQDNSFIYDHKDHKFLNREVSSDSQSLSIMVYLDNLKVLDLSQCLELEDIQGIPKNLRKLYLGGTAIKELPSLMHLSELVVLDLENCKRLHKLPMGIGNLSSLAVLNLSGCSELEDIQGIPRNLEELYLAGTAIQEVTSLIKHLSELVVLDLQNCKRLQHLPMEISNLKSLVTLKLTDPSGMSIREVSTSIIQNGISEIGISNLNYLLLTFNENAEQRREYLPRPRLPSSSLHGLVPRFYALVSLSLFNASLMHIPEEICSLPSVVLLDLGRNGFSKIPESIKQLSKLHSLRLRHCRNLILLPALPQSLKLLNVHGCVSLESVSWGFEQFPSHYTFSDCFNKSPKVARKRVVKGLAKVASIGNEHQQELIKALAFSICGPAGADQATSYNLRAGSFATIEITPSLRKTLLGFAIFVVVSFSDDSHNNAGLGVRCVSRWKTKKRVVTGKAEKVFRCWAPREAPEVQRDHMFVFYEDAEMHRGGGEGNKPNIMADHVEFEFQAVNGRNKVLGGNCMVTECDVCVITAATGAASLSVTNASKDMSLSKNHSPKLSSVIGKLRFKRVGRFGGCVCLE

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
6-131 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DVYISFDRSEDTVRYSFVSHLCAAFRRRGISSFIRENGSDSESNGFSKLETSRASVVVFSEKYSSSKSCMEELVKVSERRRKNCLAVVPVFYPVTKSFMKKQIWNLGDVRSDWPSALLETVDLPGH

Gene3D: G3DSA:3.40.50.10140
6-107 G3DSA:3.40.50.10140

DVYISFDRSEDTVRYSFVSHLCAAFRRRGISSFIRENGSDSESNGFSKLETSRASVVVFSEKYSSSKSCMEELVKVSERRRKNCLAVVPVFYPVTKSFMKKQ

ProfileScan: PS50104
IPR000157
6-102 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DVYISFDRSEDTVRYSFVSHLCAAFRRRGISSFIRENGSDSESNGFSKLETSRASVVVFSEKYSSSKSCMEELVKVSERRRKNCLAVVPVFYPVTKS

HMMPfam: PF01582
IPR000157
7-107 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VYISFDRSEDTVRYSFVSHLCAAFRRRGISSFIRENGSDSESNGFSKLETSRASVVVFSEKYSSSKSCMEELVKVSERRRKNCLAVVPVFYPVTKSFMKKQ

HMMPanther: PTHR23155
14-1039 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SEDTVRYSFVSHLCAAFRRRGISSFIRENGSDSESNGFSKLETSRASVVVFSEKYSSSKSCMEELVKVSERRRKNCLAVVPVFYPVTKSFMKKQIWNLGDVRSDWPSALLETVDLPGHELYDTQSDSDFVEEIVADVREKLNMSDNIGIYSKLGKIETLIYKQPWGVRSIGIWGMPGIGKTTLAKAAFDQLSGDYEASCFIKDFNKAFHEKGLYGLLEAHFGKILREELGIKSSITRPILLRNVLRHKRVLVVLDDVCKPLDAESFLGGFDWFCPGSLIIITSRDKQVFSICRVDQIYEVPGLNEEEALQLFSRCAFGKEIIHESLQKLSKKVIDYANGNPLALIFFGCMSRKNPKPIEIAFPKVKKYLAHEIHDAVKSTYDSLSSNEKNIFLDIACLFRGENVDCVIHLLEGCGFFPRVEINVLVEKCLVSMAEGRVVMHNLIQSIGRKIINGGKRRSRLWKPLIIKYFLEDRQVLGSEDIEAIFLDPSALSFDVNPMAFENMYNLRYLKICSSNPGNHYALHLPKGVKSLPEELRLLHWEHFPLLSLPQDFNTRNLVILNMCYSKLQRLWEGTKELGMLKRIMLCHSQQLVGIQELQIALNMEVIDLQGCARLQRFLATGHFQHLRVINLSGCIKIKSFPEVPPNIEELYLKQTGIRSIPTVTFSPQDNSFIYDHKDHKFLNREVSSDSQSLSIMVYLDNLKVLDLSQCLELEDIQGIPKNLRKLYLGGTAIKELPSLMHLSELVVLDLENCKRLHKLPMGIGNLSSLAVLNLSGCSELEDIQGIPRNLEELYLAGTAIQEVTSLIKHLSELVVLDLQNCKRLQHLPMEISNLKSLVTLKLTDPSGMSIREVSTSIIQNGISEIGISNLNYLLLTFNENAEQRREYLPRPRLPSSSLHGLVPRFYALVSLSLFNASLMHIPEEICSLPSVVLLDLGRNGFSKIPESIKQLSKLHSLRLRHCRNLILLPALPQSLKLLNVHGCVSLESVSWGFEQFPSHYTFSDCFNKSPKVARKRVVKGLAKVA

HMMPanther: PTHR23155:SF285
14-1039 PTHR23155:SF285,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

SEDTVRYSFVSHLCAAFRRRGISSFIRENGSDSESNGFSKLETSRASVVVFSEKYSSSKSCMEELVKVSERRRKNCLAVVPVFYPVTKSFMKKQIWNLGDVRSDWPSALLETVDLPGHELYDTQSDSDFVEEIVADVREKLNMSDNIGIYSKLGKIETLIYKQPWGVRSIGIWGMPGIGKTTLAKAAFDQLSGDYEASCFIKDFNKAFHEKGLYGLLEAHFGKILREELGIKSSITRPILLRNVLRHKRVLVVLDDVCKPLDAESFLGGFDWFCPGSLIIITSRDKQVFSICRVDQIYEVPGLNEEEALQLFSRCAFGKEIIHESLQKLSKKVIDYANGNPLALIFFGCMSRKNPKPIEIAFPKVKKYLAHEIHDAVKSTYDSLSSNEKNIFLDIACLFRGENVDCVIHLLEGCGFFPRVEINVLVEKCLVSMAEGRVVMHNLIQSIGRKIINGGKRRSRLWKPLIIKYFLEDRQVLGSEDIEAIFLDPSALSFDVNPMAFENMYNLRYLKICSSNPGNHYALHLPKGVKSLPEELRLLHWEHFPLLSLPQDFNTRNLVILNMCYSKLQRLWEGTKELGMLKRIMLCHSQQLVGIQELQIALNMEVIDLQGCARLQRFLATGHFQHLRVINLSGCIKIKSFPEVPPNIEELYLKQTGIRSIPTVTFSPQDNSFIYDHKDHKFLNREVSSDSQSLSIMVYLDNLKVLDLSQCLELEDIQGIPKNLRKLYLGGTAIKELPSLMHLSELVVLDLENCKRLHKLPMGIGNLSSLAVLNLSGCSELEDIQGIPRNLEELYLAGTAIQEVTSLIKHLSELVVLDLQNCKRLQHLPMEISNLKSLVTLKLTDPSGMSIREVSTSIIQNGISEIGISNLNYLLLTFNENAEQRREYLPRPRLPSSSLHGLVPRFYALVSLSLFNASLMHIPEEICSLPSVVLLDLGRNGFSKIPESIKQLSKLHSLRLRHCRNLILLPALPQSLKLLNVHGCVSLESVSWGFEQFPSHYTFSDCFNKSPKVARKRVVKGLAKVA

HMMPfam: PF00931
IPR002182
178-432 NB-ARC,NBS
NB-ARC

WGVRSIGIWGMPGIGKTTLAKAAFDQLSGDYEASCFIKDFNKAFHEKGLYGLLEAHFGKILREELGIKSSITRPILLRNVLRHKRVLVVLDDVCKPLDAESFLGGFDWFCPGSLIIITSRDKQVFSICRVDQIYEVPGLNEEEALQLFSRCAFGKEIIHESLQKLSKKVIDYANGNPLALIFFGCMSRKNPKPIEIAFPKVKKYLAHEIHDAVKSTYDSLSSNEKNIFLDIACLFRGENVDCVIHLLEGCGFFPR

superfamily: SSF52540
178-357 SSF52540

WGVRSIGIWGMPGIGKTTLAKAAFDQLSGDYEASCFIKDFNKAFHEKGLYGLLEAHFGKILREELGIKSSITRPILLRNVLRHKRVLVVLDDVCKPLDAESFLGGFDWFCPGSLIIITSRDKQVFSICRVDQIYEVPGLNEEEALQLFSRCAFGKEIIHESLQKLSKKVIDYANGNPLAL

Gene3D: G3DSA:3.40.50.300
179-327 G3DSA:3.40.50.300

GVRSIGIWGMPGIGKTTLAKAAFDQLSGDYEASCFIKDFNKAFHEKGLYGLLEAHFGKILREELGIKSSITRPILLRNVLRHKRVLVVLDDVCKPLDAESFLGGFDWFCPGSLIIITSRDKQVFSICRVDQIYEVPGLNEEEALQLFSR

FPrintScan: PR00364
IPR000767
182-197 DISEASERSIST
Disease resistance protein

SIGIWGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
257-271 DISEASERSIST
Disease resistance protein

VLRHKRVLVVLDDVC

FPrintScan: PR00364
IPR000767
350-364 DISEASERSIST
Disease resistance protein

ANGNPLALIFFGCMS

superfamily: SSF46785
384-485 SSF46785

HEIHDAVKSTYDSLSSNEKNIFLDIACLFRGENVDCVIHLLEGCGFFPRVEINVLVEKCLVSMAEGRVVMHNLIQSIGRKIINGGKRRSRLWKPLIIKYFLE

superfamily: SSF52058
452-858 SSF52058,LRR

VMHNLIQSIGRKIINGGKRRSRLWKPLIIKYFLEDRQVLGSEDIEAIFLDPSALSFDVNPMAFENMYNLRYLKICSSNPGNHYALHLPKGVKSLPEELRLLHWEHFPLLSLPQDFNTRNLVILNMCYSKLQRLWEGTKELGMLKRIMLCHSQQLVGIQELQIALNMEVIDLQGCARLQRFLATGHFQHLRVINLSGCIKIKSFPEVPPNIEELYLKQTGIRSIPTVTFSPQDNSFIYDHKDHKFLNREVSSDSQSLSIMVYLDNLKVLDLSQCLELEDIQGIPKNLRKLYLGGTAIKELPSLMHLSELVVLDLENCKRLHKLPMGIGNLSSLAVLNLSGCSELEDIQGIPRNLEELYLAGTAIQEVTSLIKHLSELVVLDLQNCKRLQHLPMEISNLKSLVTLKLTD

Gene3D: G3DSA:3.80.10.10
509-679 G3DSA:3.80.10.10

VNPMAFENMYNLRYLKICSSNPGNHYALHLPKGVKSLPEELRLLHWEHFPLLSLPQDFNTRNLVILNMCYSKLQRLWEGTKELGMLKRIMLCHSQQLVGIQELQIALNMEVIDLQGCARLQRFLATGHFQHLRVINLSGCIKIKSFPEVPPNIEELYLKQTGIRSIPTVTF

HMMPfam: PF07725
IPR011713
570-589 LRR_3
Leucine-rich repeat 3

NLVILNMCYSKLQRLWEGTK

ProfileScan: PS51450
IPR001611
639-659 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRVINLSGCIKIKSFPEVPP

ProfileScan: PS51450
IPR001611
660-681 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIEELYLKQTGIRSIPTVTFSP

Gene3D: G3DSA:3.80.10.10
707-892 G3DSA:3.80.10.10

LSIMVYLDNLKVLDLSQCLELEDIQGIPKNLRKLYLGGTAIKELPSLMHLSELVVLDLENCKRLHKLPMGIGNLSSLAVLNLSGCSELEDIQGIPRNLEELYLAGTAIQEVTSLIKHLSELVVLDLQNCKRLQHLPMEISNLKSLVTLKLTDPSGMSIREVSTSIIQNGISEIGISNLNYLLLTFN

ProfileScan: PS51450
IPR001611
715-735 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKVLDLSQCLELEDIQGIPK

ProfileScan: PS51450
IPR001611
736-757 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRKLYLGGTAIKELPSLMHLS

FPrintScan: PR00364
IPR000767
778-794 DISEASERSIST
Disease resistance protein

GNLSSLAVLNLSGCSEL

superfamily: SSF52047
801-1012 SSF52047,LRR

PRNLEELYLAGTAIQEVTSLIKHLSELVVLDLQNCKRLQHLPMEISNLKSLVTLKLTDPSGMSIREVSTSIIQNGISEIGISNLNYLLLTFNENAEQRREYLPRPRLPSSSLHGLVPRFYALVSLSLFNASLMHIPEEICSLPSVVLLDLGRNGFSKIPESIKQLSKLHSLRLRHCRNLILLPALPQSLKLLNVHGCVSLESVSWGFEQFPS

ProfileScan: PS51450
IPR001611
803-824 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELYLAGTAIQEVTSLIKHL

ProfileScan: PS51450
IPR001611
826-849 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELVVLDLQNCKRLQHLPMEISNLK

HMMPfam: PF00560
IPR001611
827-848 LRR_1
Leucine-rich repeat

LVVLDLQNCKRLQHLPMEISNL

Gene3D: G3DSA:3.80.10.10
911-1011 G3DSA:3.80.10.10

SLHGLVPRFYALVSLSLFNASLMHIPEEICSLPSVVLLDLGRNGFSKIPESIKQLSKLHSLRLRHCRNLILLPALPQSLKLLNVHGCVSLESVSWGFEQFP

ProfileScan: PS51450
IPR001611
944-965 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SVVLLDLGRNGFSKIPESIKQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox