PRGDB00046999 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18396809 (NM_111293)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT3G04220) mRNA, complete cds.

DNA Sequence

ATGGATTCTTCTTTTTTACTCGAAACTGTTGCTGCTGCAACAGGCTTCTTCACACTTTTGGGTACAATACTTTTTATGGTTTACAGAAAATTCAAAGACCATCGAGAAAACAAAGAAAATGATTCTTCTTCTTCAACACAACCGTCTCCTTCACCACCTCTGTCGTCTTTATCTCTCACGCGAAAATACGATGTCTTTCCAAGCTTCCGCGGGGAAGATGTCCGCAAAGACTTCCTCAGTCACATTCAGAAGGAGTTTCAAAGACAAGGAATCACACCATTTGTTGATAACAATATCAAGAGAGGAGAATCTATCGGTCCAGAACTCATTCGGGCGATTAGAGGGTCCAAGATCGCAATCATCTTGCTCTCCAAGAACTACGCTTCTTCAAGCTGGTGCTTAGACGAATTGGTGGAGATCATAAAGTGCAAGGAAGAAATGGGTCAAACAGTGATAGTCATTTTCTACAAAGTGGATCCATCTCTTGTAAAGAAGCTGACCGGTGATTTCGGGAAGGTATTCAGAAACACTTGTAAGGGTAAAGAAAGAGAAAACATTGAAAGATGGAGAGAAGCTTTCAAAAAAGTAGCAACAATAGCTGGTTACGATTCAAGAAAATGGGATAACGAATCGGGCATGATCGAAAAAATAGTCAGTGATATTTCGGAAATGCTGAATCATTCGACGCCGTCACGTGATTTTGACGATTTGATTGGGATGGGAGATCACATGGAAAAGATGAAACCATTGTTAGACATAGACTCAGATGAAATGAAGACGATAGGAATATGGGGTCCTCCTGGGGTTGGCAAAACCACCATTGCTAGATCTTTATATAATCAACACTCGGACAAATTTCAACTGAGTGTCTTTATGGAGAGTATCAAAACCGCGTACACAATACCAGCGTGTTCCGATGACTACTATGAAAAGTTGCAACTACAACAACGGTTTCTGTCTCAAATAACCAACCAGGAAAATGTCCAGATCCCACATTTAGGAGTTGCACAAGAAAGGTTGAACGACAAGAAAGTTCTTGTTGTTATTGATGATGTGAATCAGTCAGTACAAGTAGATGCCTTGGCGAAAGAAAATGATTGGCTAGGTCCTGGGAGTCGGATTATCATCACAACCCAAGACCGAGGAATTTTGAGGGCGCATGGGATCGAACATATTTACGAGGTGGATTATCCCAACTATGAAGAGGCCCTTCAAATCTTTTGCATGCATGCTTTTGGTCAAAAGTCCCCATATGATGGTTTTGAGGAGCTTGCTCAACAAGTTACAACACTTTCGGGTAGACTTCCTTTGGGACTTAAGGTTATGGGATCCTATTTCCGGGGAATGACCAAGCAGGAGTGGACAATGGCACTACCAAGGGTAAGGACTCACCTTGACGGAAAAATTGAGAGCATTCTAAAACTCAGTTACGATGCCTTATGTGATGTAGATAAAAGTTTGTTCCTTCATCTAGCTTGCTCTTTCCACAATGATGATACCGAGTTAGTAGAACAGCAGCTTGGAAAGAAGTTCTCGGATTTGAGGCAAGGGCTTCACGTCTTAGCTGAGAAATCGCTTATACATATGGATTTAAGACTGATACGTATGCATGTTCTGCTGGCACAACTTGGTAGAGAAATTGTTCGTAAACAATCCATTCATGAGCCTGGACAACGTCAATTTTTGGTTGATGCAACAGATATTCGTGAAGTACTCACTGATGATACAGGCAGTAGAAGTGTAATAGGCATAGATTTCGACTTCAATACGATGGAGAAAGAATTAGATATAAGTGAGAAAGCCTTCCGAGGAATGTCTAATCTTCAGTTCATAAGAATTTATGGTGACCTTTTTAGCCGTCACGGAGTATACTATTTTGGCGGTCGCGGTCACCGCGTGTCTCTGGATTATGATAGTAAATTGCACTTCCCGCGAGGTCTGGACTATTTACCTGGAAAACTTAGGTTATTACATTGGCAACAATTTCCGATGACAAGTTTGCCCTCTGAGTTTCATGCGGAGTTCCTTGTTAAACTATGCATGCCCTACAGCAAGCTTGAGAAGTTGTGGGAAGGAATTCAACCGCTTAGAAATCTCGAGTGGCTGGATTTGACTTGTTCCAGAAATCTGAAGGAGCTTCCTGATCTTTCAACAGCCACTAATCTCCAAAGACTGTCCATTGAGCGTTGCTCAAGTTTGGTGAAGCTCCCTTCCTCTATTGGGGAAGCCACTAATCTCAAGAAAATAAACTTGAGAGAGTGCTTATCTCTGGTGGAATTACCCTCCTCATTTGGGAATCTTACTAATCTCCAAGAATTGGATCTTAGAGAATGCTCAAGTCTAGTGGAGCTCCCAACCTCGTTTGGGAATCTTGCTAATGTTGAAAGCCTGGAATTTTATGAATGCTCAAGTTTGGTGAAGCTCCCATCAACTTTTGGGAATCTTACTAATCTCAGAGTGTTGGGTCTTAGAGAATGCTCAAGTATGGTGGAGCTCCCATCCTCGTTTGGGAATCTTACTAATCTCCAAGTATTGAATCTTAGAAAATGCTCAACTCTGGTGGAACTCCCCTCCTCATTTGTGAATCTTACTAATCTCGAAAATTTGGATCTTAGAGATTGCTCAAGTCTACTCCCCTCCTCGTTTGGGAATGTCACTTATCTCAAGAGATTGAAGTTTTATAAATGCTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MDSSFLLETVAAATGFFTLLGTILFMVYRKFKDHRENKENDSSSSTQPSPSPPLSSLSLTRKYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLTDDTGSRSVIGIDFDFNTMEKELDISEKAFRGMSNLQFIRIYGDLFSRHGVYYFGGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
61-199 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RKYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATI

Gene3D: G3DSA:3.40.50.10140
61-198 G3DSA:3.40.50.10140

RKYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVAT

HMMSmart: SM00255
IPR000157
62-199 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATI

HMMPfam: PF01582
IPR000157
65-193 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAF

HMMPanther: PTHR23155
73-896 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLTDDTGSRSVIGIDFDFNTMEKELDISEKAFRGMSNLQFIRIYGDLFSRHGVYYFGGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

HMMPanther: PTHR23155:SF299
73-896 PTHR23155:SF299

DVRKDFLSHIQKEFQRQGITPFVDNNIKRGESIGPELIRAIRGSKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLTDDTGSRSVIGIDFDFNTMEKELDISEKAFRGMSNLQFIRIYGDLFSRHGVYYFGGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

superfamily: SSF52540
116-489 SSF52540

SKIAIILLSKNYASSSWCLDELVEIIKCKEEMGQTVIVIFYKVDPSLVKKLTGDFGKVFRNTCKGKERENIERWREAFKKVATIAGYDSRKWDNESGMIEKIVSDISEMLNHSTPSRDFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFL

Gene3D: G3DSA:3.40.50.300
233-270 G3DSA:3.40.50.300

DFDDLIGMGDHMEKMKPLLDIDSDEMKTIGIWGPPGVG

HMMPfam: PF00931
IPR002182
242-497 NB-ARC,NBS
NB-ARC

DHMEKMKPLLDIDSDEMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLPLGLKVMGSYFRGMTKQEWTMALPRVRTHLDGKIESILKLSYDALCDVDKSLFLHLACSFHN

HMMSmart: SM00382
IPR003593
257-398 AAA,NBS
AAA+ ATPase domain

EMKTIGIWGPPGVGKTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYP

FPrintScan: PR00364
IPR000767
260-275 DISEASERSIST
Disease resistance protein

TIGIWGPPGVGKTTIA

Gene3D: G3DSA:3.40.50.300
271-436 G3DSA:3.40.50.300

KTTIARSLYNQHSDKFQLSVFMESIKTAYTIPACSDDYYEKLQLQQRFLSQITNQENVQIPHLGVAQERLNDKKVLVVIDDVNQSVQVDALAKENDWLGPGSRIIITTQDRGILRAHGIEHIYEVDYPNYEEALQIFCMHAFGQKSPYDGFEELAQQVTTLSGRLP

FPrintScan: PR00364
IPR000767
339-353 DISEASERSIST
Disease resistance protein

RLNDKKVLVVIDDVN

FPrintScan: PR00364
IPR000767
432-446 DISEASERSIST
Disease resistance protein

SGRLPLGLKVMGSYF

superfamily: SSF46785
467-573 SSF46785

GKIESILKLSYDALCDVDKSLFLHLACSFHNDDTELVEQQLGKKFSDLRQGLHVLAEKSLIHMDLRLIRMHVLLAQLGREIVRKQSIHEPGQRQFLVDATDIREVLT

superfamily: SSF52058
627-896 SSF52058,LRR

GGRGHRVSLDYDSKLHFPRGLDYLPGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

Gene3D: G3DSA:3.80.10.10
651-896 G3DSA:3.80.10.10

PGKLRLLHWQQFPMTSLPSEFHAEFLVKLCMPYSKLEKLWEGIQPLRNLEWLDLTCSRNLKELPDLSTATNLQRLSIERCSSLVKLPSSIGEATNLKKINLRECLSLVELPSSFGNLTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSLVKLPSTFGNLTNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDCSSLLPSSFGNVTYLKRLKFYKC

HMMPfam: PF07725
IPR011713
675-694 LRR_3
Leucine-rich repeat 3

FLVKLCMPYSKLEKLWEGIQ

HMMPfam: PF00560
IPR001611
745-767 LRR_1
Leucine-rich repeat

NLKKINLRECLSLVELPSSFGNL

FPrintScan: PR00364
IPR000767
765-781 DISEASERSIST
Disease resistance protein

GNLTNLQELDLRECSSL

HMMPfam: PF00560
IPR001611
769-791 LRR_1
Leucine-rich repeat

NLQELDLRECSSLVELPTSFGNL

HMMPfam: PF13855
816-874 LRR_8,Leucine rich repeat

TNLRVLGLRECSSMVELPSSFGNLTNLQVLNLRKCSTLVELPSSFVNLTNLENLDLRDC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox