PRGDB00047000 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18405867 (NM_104531)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G56540) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCTTCTTCACGTCGCACCTGGAGATACAATGTCTTCACGAGTTTCCATGGACCAGACGTCCGCAAAACATTTCTCAGTCATTTACGCAAACAATTTAACTACAATGGAATTACAATGTTCGATGATCAAAGGATCGAGAGAAGCCAAATCATCGCCCCAGCTCTCACGGAAGCGATTAGAGAATCAAGGATCGCTATCGTATTGCTCTCGAAGAACTATGCTTCTTCCAGTTGGTGTTTGGATGAGTTGTTGGAGATTTTAGATTGCAAAGAACAATTAGGGCAGATTGTGATGACTGTCTTCTACGGAGTACATCCTTCTGATGTAAGGAAACAAACTGGAGATTTCGGGATTGCTTTCAATGAAACATGTGCTCGTAAAACAGAGGAGCAGAGGCAAAAATGGAGCCAAGCGTTGACCTATGTGGGCAACATCGCTGGAGAACATTTCCAAAACTGGGACAATGAAGCGAAGATGATAGAGAAGATTGCAAGTGATGTTTCAGATAAACTCAATACCACACCGTCTAGGGATTTTGATGGCATGATTGGACTTGAAGCTCATTTGAGAAAAATAGAGTCTTTGCTTGATTTAGATTATGATGGAGCTAAGATTGTTGGAATCTCTGGTCCTGCAGGCATTGGTAAGAGTACCATTGCCAGAGCTTTACATAGTGTACTATCTAAACGGTTTCAGCATAATTGTTTTATGGACAACCTTCATGAAAGCTATAAGATTGGTCTTGTTGAGTATGGTTTGAGGTTGCGGTTACAAGAGCAACTTCTTTCAAAGATTTTGAACCTAGATGGCATTAGGATAGCCCATTTAGGTGTGATACGAGAGAGGCTACACGACCAGAAGGTTCTTATCATTCTTGATGATGTGGAGAGTCTAGATCAACTTGATGCTTTGGCTAATATCGAGTGGTTTGGTCCTGGAAGTAGGGTCATAGTGACCACTGAAAACAAAGAGATTTTACAGCAACATGGTATCAGTGATATATACCACGTGGGTTTTCCATCAAGTAAAGAAGCTTTAATGATCTTTTGTCTATCCGCTTTTAGACAACTCTCTCCACCTGATCGGTTTATGAATCTTGCTGCTGAAGTTGCAAAGCTTTGTGGTTATCTTCCATTGGCTCTGCATGTTTTAGGGTCATCATTGCGGGGAAAGAACTATTCTGACTGGATAGAAGAACTACCAAGATTGCAAACTTGTCTTGATGGAAGAATTGAGAGTGTATTGAAAGTGGGCTATGAAAGTTTACATGAGAAAGACCAAGCTCTATTTCTCTACATTGCAGTCTTCTTCAATTATCAACATGCTGATTATGTGACATCCATGCTGGCAAAAACTAACTTGAATGTTAGACTTGGGTTAAAAATATTAGCCAATAGACATCTTATACATATAGGTCATGGCGCTAAAGGTATAGTGGTAATGCACCGTTTGCTAAAAGTAATGGCTAGACAAGTCATTTCCAAACAAGAGCCTTGGAAACGCCAGATTCTTGTAGATACCCAAGAGATTTCTTATGTTTTGGAAAATGCAGAAGGTAATGGATCAATCGCAGGTATATCATTTGACGTAGGAGAGATCAACAAATTAACAATAAGCGCTAAGGCGTTTGAAAGAATGCACAATCTTTTGTTGCTAAAAGTTTACGATCCGTGGTTTACTGGAAAAGGACAAGTGCACATTCCAGAGGAGATGGATTTTCTTCCTCGCCTAAGCTTACTTCGTTGGGATGCATACACGAGAAAGACCCTTCCTCGTAGATTCTGCCCAGAAAATCTCGTCGAACTCAACATGCCGGATAGCCAGCTCGAGAAGCTATGGGAAGGAACTCAGCTGCTTGCAAATCTCAAAACGATGAAGCTCTCTAGGTCATCTCGTTTGAAGGAACTCCCAAATCTTTCAAATGCTAAAAATCTGGAGCGTCTGGATTTGCATGAATGCGTTGCTTTGTTAGAGCTTCCATCCTCAATTTCTAATCTTCATAAACTATACTTCTTAGAGACGAATCATTGCAGACGTCTACAAGTCATTCCAACTCTCACCAACTTGGTATCTCTCGAAGATATCAAGATGATGGGATGCTTACGACTGAAAAGTTTTCCAGATATTCCTGCCAACATCATTAGGCTCTCTGTAATGGAGACTACGATTGCAGAATTTCCCGCGTCACTTAGGCATTTCTCGCATATTGAGTCTTTCGATATAAGTGGCAGTGTAAATCTCAAGACCTTTTCAACACTTCTCCCCACGAGTGTAACAGAGCTACACATAGACAACAGTGGTATTGAGAGTATTACAGATTGCATCAAAGGTCTTCATAATCTACGTGTCCTTGCTCTATCAAACTGTAAAAAACTCACGTCATTGCCGAAGCTTCCTAGTTCACTCAAATGGCTACGGGCAAGCCATTGTGAATCACTGGAGAGAGTAAGTGAACCTTTAAACACTCCAAATGCAGACCTTGATTTCAGCAACTGTTTCAAATTGGATCGACAAGCGCGACAAGCGATTTTTCAACAACGGTTTGTTGATGGGCGAGCTCTCTTACCAGGAAGAAAAGTACCTGCACTGTTCGATCATCGAGCCAGAGGAAATTCATTAACAATTCCTAATTCTGCTTCCTATAAGGTTTGCGTTGTGATTTCTACAGAGTTTGATCATAAAGACAGAGATTCTACCATAGTTTCAAGACTACTGTGTCGTTGCATAGTCATCAGCAACTCAGTAAACTCCACTGACAAGGAGTTTGTACTAACGGATGTCTATAAATATCGAATGGAACATCTATTTATATTTCATATGGTGAACCCGGTGTCCTTTTTCTACCCCTCTAGCAGAGAGATAGTGCTCGAATTCAGCAGCATACACAAACATTTCGACATTGTTGAATGTGGTGTCCAGATCTTGACGGATGAAACAGAGCGAAACAACAATGTGGGTTCTGCAGATGAAGATGATCTCTGGTATATACATGAATTCAGCGAATCGTTACGCAAAGAAGAAAAAGATAAAGATAGCGTCGCTAAATCTGAATCCTGCGGAGCGTCAGAAAAAGAAGATGAGGAAGCAACCAAAGACAAAGATGAGGATATCGCCGAACACAGTGATTCCGAATCCATATCCGAGAACCGTCCGAGGAAGAGGACGATGATAAGTGCTACTACTAATCTGAAGAAATGGTTTCTCTGTCTTTTTCTTTTCTTCTTTTTCTCTTTTGCTTTTGTTAAATTCTCCATCTACTTTGATCTTTTCTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSSSRRTWRYNVFTSFHGPDVRKTFLSHLRKQFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALTYVGNIAGEHFQNWDNEAKMIEKIASDVSDKLNTTPSRDFDGMIGLEAHLRKIESLLDLDYDGAKIVGISGPAGIGKSTIARALHSVLSKRFQHNCFMDNLHESYKIGLVEYGLRLRLQEQLLSKILNLDGIRIAHLGVIRERLHDQKVLIILDDVESLDQLDALANIEWFGPGSRVIVTTENKEILQQHGISDIYHVGFPSSKEALMIFCLSAFRQLSPPDRFMNLAAEVAKLCGYLPLALHVLGSSLRGKNYSDWIEELPRLQTCLDGRIESVLKVGYESLHEKDQALFLYIAVFFNYQHADYVTSMLAKTNLNVRLGLKILANRHLIHIGHGAKGIVVMHRLLKVMARQVISKQEPWKRQILVDTQEISYVLENAEGNGSIAGISFDVGEINKLTISAKAFERMHNLLLLKVYDPWFTGKGQVHIPEEMDFLPRLSLLRWDAYTRKTLPRRFCPENLVELNMPDSQLEKLWEGTQLLANLKTMKLSRSSRLKELPNLSNAKNLERLDLHECVALLELPSSISNLHKLYFLETNHCRRLQVIPTLTNLVSLEDIKMMGCLRLKSFPDIPANIIRLSVMETTIAEFPASLRHFSHIESFDISGSVNLKTFSTLLPTSVTELHIDNSGIESITDCIKGLHNLRVLALSNCKKLTSLPKLPSSLKWLRASHCESLERVSEPLNTPNADLDFSNCFKLDRQARQAIFQQRFVDGRALLPGRKVPALFDHRARGNSLTIPNSASYKVCVVISTEFDHKDRDSTIVSRLLCRCIVISNSVNSTDKEFVLTDVYKYRMEHLFIFHMVNPVSFFYPSSREIVLEFSSIHKHFDIVECGVQILTDETERNNNVGSADEDDLWYIHEFSESLRKEEKDKDSVAKSESCGASEKEDEEATKDKDEDIAEHSDSESISENRPRKRTMISATTNLKKWFLCLFLFFFFSFAFVKFSIYFDLF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
3-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSSSSSRRTWRYNVFTSFHGPDVRKTFLSHLRKQFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALTYVGNIAGE

Gene3D: G3DSA:3.40.50.10140
10-146 G3DSA:3.40.50.10140

RRTWRYNVFTSFHGPDVRKTFLSHLRKQFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALT

ProfileScan: PS50104
IPR000157
13-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRYNVFTSFHGPDVRKTFLSHLRKQFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALTYVGNI

HMMSmart: SM00255
IPR000157
14-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYNVFTSFHGPDVRKTFLSHLRKQFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALTYVGNI

HMMPfam: PF01582
IPR000157
17-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFTSFHGPDVRKTFLSHLRKQFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALT

HMMPanther: PTHR11017
37-1043 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALTYVGNIAGEHFQNWDNEAKMIEKIASDVSDKLNTTPSRDFDGMIGLEAHLRKIESLLDLDYDGAKIVGISGPAGIGKSTIARALHSVLSKRFQHNCFMDNLHESYKIGLVEYGLRLRLQEQLLSKILNLDGIRIAHLGVIRERLHDQKVLIILDDVESLDQLDALANIEWFGPGSRVIVTTENKEILQQHGISDIYHVGFPSSKEALMIFCLSAFRQLSPPDRFMNLAAEVAKLCGYLPLALHVLGSSLRGKNYSDWIEELPRLQTCLDGRIESVLKVGYESLHEKDQALFLYIAVFFNYQHADYVTSMLAKTNLNVRLGLKILANRHLIHIGHGAKGIVVMHRLLKVMARQVISKQEPWKRQILVDTQEISYVLENAEGNGSIAGISFDVGEINKLTISAKAFERMHNLLLLKVYDPWFTGKGQVHIPEEMDFLPRLSLLRWDAYTRKTLPRRFCPENLVELNMPDSQLEKLWEGTQLLANLKTMKLSRSSRLKELPNLSNAKNLERLDLHECVALLELPSSISNLHKLYFLETNHCRRLQVIPTLTNLVSLEDIKMMGCLRLKSFPDIPANIIRLSVMETTIAEFPASLRHFSHIESFDISGSVNLKTFSTLLPTSVTELHIDNSGIESITDCIKGLHNLRVLALSNCKKLTSLPKLPSSLKWLRASHCESLERVSEPLNTPNADLDFSNCFKLDRQARQAIFQQRFVDGRALLPGRKVPALFDHRARGNSLTIPNSASYKVCVVISTEFDHKDRDSTIVSRLLCRCIVISNSVNSTDKEFVLTDVYKYRMEHLFIFHMVNPVSFFYPSSREIVLEFSSIHKHFDIVECGVQILTDETERNNNVGSADEDDLWYIHEFSESLRKEEKDKDSVAKSESCGASEKEDEEATKDKDEDI

HMMPanther: PTHR11017:SF20
37-1043 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFNYNGITMFDDQRIERSQIIAPALTEAIRESRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALTYVGNIAGEHFQNWDNEAKMIEKIASDVSDKLNTTPSRDFDGMIGLEAHLRKIESLLDLDYDGAKIVGISGPAGIGKSTIARALHSVLSKRFQHNCFMDNLHESYKIGLVEYGLRLRLQEQLLSKILNLDGIRIAHLGVIRERLHDQKVLIILDDVESLDQLDALANIEWFGPGSRVIVTTENKEILQQHGISDIYHVGFPSSKEALMIFCLSAFRQLSPPDRFMNLAAEVAKLCGYLPLALHVLGSSLRGKNYSDWIEELPRLQTCLDGRIESVLKVGYESLHEKDQALFLYIAVFFNYQHADYVTSMLAKTNLNVRLGLKILANRHLIHIGHGAKGIVVMHRLLKVMARQVISKQEPWKRQILVDTQEISYVLENAEGNGSIAGISFDVGEINKLTISAKAFERMHNLLLLKVYDPWFTGKGQVHIPEEMDFLPRLSLLRWDAYTRKTLPRRFCPENLVELNMPDSQLEKLWEGTQLLANLKTMKLSRSSRLKELPNLSNAKNLERLDLHECVALLELPSSISNLHKLYFLETNHCRRLQVIPTLTNLVSLEDIKMMGCLRLKSFPDIPANIIRLSVMETTIAEFPASLRHFSHIESFDISGSVNLKTFSTLLPTSVTELHIDNSGIESITDCIKGLHNLRVLALSNCKKLTSLPKLPSSLKWLRASHCESLERVSEPLNTPNADLDFSNCFKLDRQARQAIFQQRFVDGRALLPGRKVPALFDHRARGNSLTIPNSASYKVCVVISTEFDHKDRDSTIVSRLLCRCIVISNSVNSTDKEFVLTDVYKYRMEHLFIFHMVNPVSFFYPSSREIVLEFSSIHKHFDIVECGVQILTDETERNNNVGSADEDDLWYIHEFSESLRKEEKDKDSVAKSESCGASEKEDEEATKDKDEDI

superfamily: SSF52540
68-437 SSF52540

SRIAIVLLSKNYASSSWCLDELLEILDCKEQLGQIVMTVFYGVHPSDVRKQTGDFGIAFNETCARKTEEQRQKWSQALTYVGNIAGEHFQNWDNEAKMIEKIASDVSDKLNTTPSRDFDGMIGLEAHLRKIESLLDLDYDGAKIVGISGPAGIGKSTIARALHSVLSKRFQHNCFMDNLHESYKIGLVEYGLRLRLQEQLLSKILNLDGIRIAHLGVIRERLHDQKVLIILDDVESLDQLDALANIEWFGPGSRVIVTTENKEILQQHGISDIYHVGFPSSKEALMIFCLSAFRQLSPPDRFMNLAAEVAKLCGYLPLALHVLGSSLRGKNYSDWIEELPRLQTCLDGRIESVLKVGYESLHEKDQALFL

Gene3D: G3DSA:3.40.50.300
182-332 G3DSA:3.40.50.300

SRDFDGMIGLEAHLRKIESLLDLDYDGAKIVGISGPAGIGKSTIARALHSVLSKRFQHNCFMDNLHESYKIGLVEYGLRLRLQEQLLSKILNLDGIRIAHLGVIRERLHDQKVLIILDDVESLDQLDALANIEWFGPGSRVIVTTENKEIL

HMMPfam: PF00931
IPR002182
192-449 NB-ARC,NBS
NB-ARC

EAHLRKIESLLDLDYDGAKIVGISGPAGIGKSTIARALHSVLSKRFQHNCFMDNLHESYKIGLVEYGLRLRLQEQLLSKILNLDGIRIAHLGVIRERLHDQKVLIILDDVESLDQLDALANIEWFGPGSRVIVTTENKEILQQHGISDIYHVGFPSSKEALMIFCLSAFRQLSPPDRFMNLAAEVAKLCGYLPLALHVLGSSLRGKNYSDWIEELPRLQTCLDGRIESVLKVGYESLHEKDQALFLYIAVFFNYQHAD

HMMSmart: SM00382
IPR003593
208-367 AAA,NBS
AAA+ ATPase domain

GAKIVGISGPAGIGKSTIARALHSVLSKRFQHNCFMDNLHESYKIGLVEYGLRLRLQEQLLSKILNLDGIRIAHLGVIRERLHDQKVLIILDDVESLDQLDALANIEWFGPGSRVIVTTENKEILQQHGISDIYHVGFPSSKEALMIFCLSAFRQLSPPD

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

IVGISGPAGIGKSTIA

FPrintScan: PR00364
IPR000767
288-302 DISEASERSIST
Disease resistance protein

RLHDQKVLIILDDVE

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

CGYLPLALHVLGSSL

superfamily: SSF46785
415-521 SSF46785

GRIESVLKVGYESLHEKDQALFLYIAVFFNYQHADYVTSMLAKTNLNVRLGLKILANRHLIHIGHGAKGIVVMHRLLKVMARQVISKQEPWKRQILVDTQEISYVLE

superfamily: SSF52058
516-841 SSF52058,LRR

ISYVLENAEGNGSIAGISFDVGEINKLTISAKAFERMHNLLLLKVYDPWFTGKGQVHIPEEMDFLPRLSLLRWDAYTRKTLPRRFCPENLVELNMPDSQLEKLWEGTQLLANLKTMKLSRSSRLKELPNLSNAKNLERLDLHECVALLELPSSISNLHKLYFLETNHCRRLQVIPTLTNLVSLEDIKMMGCLRLKSFPDIPANIIRLSVMETTIAEFPASLRHFSHIESFDISGSVNLKTFSTLLPTSVTELHIDNSGIESITDCIKGLHNLRVLALSNCKKLTSLPKLPSSLKWLRASHCESLERVSEPLNTPNADLDFSNCFKL

Gene3D: G3DSA:3.80.10.10
543-823 G3DSA:3.80.10.10

TISAKAFERMHNLLLLKVYDPWFTGKGQVHIPEEMDFLPRLSLLRWDAYTRKTLPRRFCPENLVELNMPDSQLEKLWEGTQLLANLKTMKLSRSSRLKELPNLSNAKNLERLDLHECVALLELPSSISNLHKLYFLETNHCRRLQVIPTLTNLVSLEDIKMMGCLRLKSFPDIPANIIRLSVMETTIAEFPASLRHFSHIESFDISGSVNLKTFSTLLPTSVTELHIDNSGIESITDCIKGLHNLRVLALSNCKKLTSLPKLPSSLKWLRASHCESLERVS

HMMPfam: PF07725
IPR011713
604-623 LRR_3
Leucine-rich repeat 3

NLVELNMPDSQLEKLWEGTQ

FPrintScan: PR00364
IPR000767
782-798 DISEASERSIST
Disease resistance protein

KGLHNLRVLALSNCKKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox