PRGDB00047001 (disease resistance protein (CC-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (CC-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18402967 (NM_103903)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G50180) mRNA, complete cds.

DNA Sequence

ATGGCAGAGGCTATTGTTTCTGTTACAGTGCAGAAGCTAGGACAGTTGCTCTTGGAAGAACCGTTGTTCTTATTTGGTATAGGTGACCAAGTGAAGCAGCTGCAAGACGAATTGAAGCGTTTGAATTGCTTTTTGAAAGATGCAGATGAGAAGCAGCATGAAAGCGAGAGAGTGCGTAACTGGGTTGCAGGCATTAGAGAAGCTTCTTATGATGCAGAGGATATCCTCGAGGCATTTTTCCTCAAAGCAGAATCAAGGAAACAAAAAGGGATGAAAAGGGTGCTTAGGAGGCTTGCTTGCATCTTGAACGAAGCGGTTTCACTTCATAGTGTTGGCTCAGAGATTAGAGAGATCACCTCCAGGCTTTCTAAGATAGCAGCAAGCATGCTAGATTTTGGTATAAAAGAATCTATGGGCAGAGAAGGTTTGAGTTTGTCTGATAGTCTAAGAGAACAGAGGCAATCGTTTCCATATGTTGTTGAGCATAATCTTGTTGGGTTAGAGCAGAGTCTAGAGAAGTTGGTGAATGATTTAGTTTCCGGAGGTGAGAAACTAAGAGTCACGTCCATCTGCGGAATGGGTGGTTTGGGGAAAACAACTTTAGCCAAACAGATTTTCCATCACCATAAAGTGAGGCGTCATTTCGATAGATTTGCTTGGGTATATGTTTCTCAAGACTGTAGACGGAGACATGTTTGGCAAGACATTTTTCTGAATCTCAGCTACAAGGATGAAAATCAGAGAATACTCAGCTTGAGGGATGAACAACTTGGAGAGGAGTTGCATCGGTTCTTGAAAAGGAATAAATGCCTCATTGTGCTTGATGATATCTGGGGCAAAGATGCTTGGGATTGTCTGAAACACGTCTTTCCACATGAAACAGGAAGCGAAATAATCCTCACTACTCGGAACAAGGAAGTCGCTTTATATGCTGATCCCAGGGGTGTGCTTCATGAGCCACAATTGCTAACATGTGAAGAGAGTTGGGAGCTGTTGGAGAAAATTTCATTATCTGGAAGAGAAAATATAGAGCCAATGTTGGTCAAGAAAATGGAGGAGATTGGGAAGCAGATAGTTGTAAGGTGTGGAGGTTTACCTCTAGCTATAACAGTTCTTGGAGGACTTCTGGCAACGAAAAGTACATGGAACGAGTGGCAAAGAGTATGCGAGAACATCAAATCATATGTTTCAAATGGAGGTAGTAGCAATGGAAGTAAGAACATGCTAGTTGCAGATGTTTTGTGCTTGAGTTACGAGTACTTGCCTCCCCATGTAAAGCAATGTTTCCTCTACTTTGCTCATTATCCTGAAGACTATGAGGTTCATGTGGGAACACTAGTTAGTTATTGCATCGCAGAGGGAATGGTTATGCCTGTAAAACACACAGAGGCTGGCACGACAGTGGAAGATGTCGGGCAAGATTATCTTGAGGAATTAGTAAAGAGAAGCATGGTTATGGTTGGGAGGAGGGACATTGTAACTTCGGAAGTCATGACATGCCGTATGCATGACCTCATGAGGGAGGTGTGTTTACAGAAGGCAAAGCAAGAAAGCTTTGTGCAAGTTATTGATTCAAGGGATCAAGATGAAGCTGAGGCTTTTATATCTCTTTCGACCAATACATCTCGTAGAATTTCTGTCCAACTACATGGTGGAGCAGAGGAGCACCATATCAAGAGTCTGTCGCAGGTTTCCTTCAGAAAGATGAAACTTCTTCGAGTTCTAGATCTTGAGGGAGCTCAAATCGAGGGAGGGAAGTTGCCAGACGATGTAGGAGATCTCATCCATTTGAGGAACCTGAGCGTGAGATTGACAAACGTGAAGGAACTTACATCATCTATTGGAAACTTAAAGTTGATGATTACTCTAGACTTGTTCGTGAAAGGGCAACTGTATATTCCAAACCAACTCTGGGATTTTCCTGTTGGAAAGTGCAATCCAAGGGATCTTTTAGCAATGACAAGTCTTAGAAGATTGTCTATCAATCTTTCTTCGCAGAACACAGACTTCGTGGTGGTGTCTTCACTAAGTAAAGTCTTGAAACGTCTCCGTGGCTTGACAATAAACGTTCCATGCGAACCTATGCTTCCACCAGTAGATGTAACACAGTTGGTCTCTGCATTTACTAATCTCTGTGAACTGGAACTGTTCCTTAAACTAGAAAAACTCCCAGGAGAACAGAGTTTCTCCTCTGATCTTGGTGCTCTACGTTTGTGGCAATGCGGATTAGTGGATGACCCGTTTATGGTTCTCGAGAAGCTTCCAAACTTGAAGATTCTCCAACTGTTTGAAGGATCATTTGTAGGTAGTAAGCTTTGTTGTTCCAAGAATCTAGAGAATCTAGAGGAGTGGACTGTAGAAGACGGTGCCATGATGCGTCTTGTCACCGTGGAGCTAAAGTGTTGTAACAAACTGAAGTCAGTTCCTGAAGGAACGAGATTCCTAAAAAATCTACAAGAAGTAGAGATTGGGAACAGGACAAAGGCATTTAAGGACAAGCTAATCTCTGGTGGTGAAGATTTCTACAAGGTTCAACATGTGCCTTGTGTTGTTTTTGAGAACTGTGAACTTTAA


Protein sequences

Name Description Sequence
disease resistance protein (CC-NBS-LRR class), putative disease resistance protein (CC-NBS-LRR class), putative [Arabidopsis thaliana].

MAEAIVSVTVQKLGQLLLEEPLFLFGIGDQVKQLQDELKRLNCFLKDADEKQHESERVRNWVAGIREASYDAEDILEAFFLKAESRKQKGMKRVLRRLACILNEAVSLHSVGSEIREITSRLSKIAASMLDFGIKESMGREGLSLSDSLREQRQSFPYVVEHNLVGLEQSLEKLVNDLVSGGEKLRVTSICGMGGLGKTTLAKQIFHHHKVRRHFDRFAWVYVSQDCRRRHVWQDIFLNLSYKDENQRILSLRDEQLGEELHRFLKRNKCLIVLDDIWGKDAWDCLKHVFPHETGSEIILTTRNKEVALYADPRGVLHEPQLLTCEESWELLEKISLSGRENIEPMLVKKMEEIGKQIVVRCGGLPLAITVLGGLLATKSTWNEWQRVCENIKSYVSNGGSSNGSKNMLVADVLCLSYEYLPPHVKQCFLYFAHYPEDYEVHVGTLVSYCIAEGMVMPVKHTEAGTTVEDVGQDYLEELVKRSMVMVGRRDIVTSEVMTCRMHDLMREVCLQKAKQESFVQVIDSRDQDEAEAFISLSTNTSRRISVQLHGGAEEHHIKSLSQVSFRKMKLLRVLDLEGAQIEGGKLPDDVGDLIHLRNLSVRLTNVKELTSSIGNLKLMITLDLFVKGQLYIPNQLWDFPVGKCNPRDLLAMTSLRRLSINLSSQNTDFVVVSSLSKVLKRLRGLTINVPCEPMLPPVDVTQLVSAFTNLCELELFLKLEKLPGEQSFSSDLGALRLWQCGLVDDPFMVLEKLPNLKILQLFEGSFVGSKLCCSKNLENLEEWTVEDGAMMRLVTVELKCCNKLKSVPEGTRFLKNLQEVEIGNRTKAFKDKLISGGEDFYKVQHVPCVVFENCEL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
2-857 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEAIVSVTVQKLGQLLLEEPLFLFGIGDQVKQLQDELKRLNCFLKDADEKQHESERVRNWVAGIREASYDAEDILEAFFLKAESRKQKGMKRVLRRLACILNEAVSLHSVGSEIREITSRLSKIAASMLDFGIKESMGREGLSLSDSLREQRQSFPYVVEHNLVGLEQSLEKLVNDLVSGGEKLRVTSICGMGGLGKTTLAKQIFHHHKVRRHFDRFAWVYVSQDCRRRHVWQDIFLNLSYKDENQRILSLRDEQLGEELHRFLKRNKCLIVLDDIWGKDAWDCLKHVFPHETGSEIILTTRNKEVALYADPRGVLHEPQLLTCEESWELLEKISLSGRENIEPMLVKKMEEIGKQIVVRCGGLPLAITVLGGLLATKSTWNEWQRVCENIKSYVSNGGSSNGSKNMLVADVLCLSYEYLPPHVKQCFLYFAHYPEDYEVHVGTLVSYCIAEGMVMPVKHTEAGTTVEDVGQDYLEELVKRSMVMVGRRDIVTSEVMTCRMHDLMREVCLQKAKQESFVQVIDSRDQDEAEAFISLSTNTSRRISVQLHGGAEEHHIKSLSQVSFRKMKLLRVLDLEGAQIEGGKLPDDVGDLIHLRNLSVRLTNVKELTSSIGNLKLMITLDLFVKGQLYIPNQLWDFPVGKCNPRDLLAMTSLRRLSINLSSQNTDFVVVSSLSKVLKRLRGLTINVPCEPMLPPVDVTQLVSAFTNLCELELFLKLEKLPGEQSFSSDLGALRLWQCGLVDDPFMVLEKLPNLKILQLFEGSFVGSKLCCSKNLENLEEWTVEDGAMMRLVTVELKCCNKLKSVPEGTRFLKNLQEVEIGNRTKAFKDKLISGGEDFYKVQHVPCVVFENCEL

HMMPanther: PTHR23155
2-857 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAIVSVTVQKLGQLLLEEPLFLFGIGDQVKQLQDELKRLNCFLKDADEKQHESERVRNWVAGIREASYDAEDILEAFFLKAESRKQKGMKRVLRRLACILNEAVSLHSVGSEIREITSRLSKIAASMLDFGIKESMGREGLSLSDSLREQRQSFPYVVEHNLVGLEQSLEKLVNDLVSGGEKLRVTSICGMGGLGKTTLAKQIFHHHKVRRHFDRFAWVYVSQDCRRRHVWQDIFLNLSYKDENQRILSLRDEQLGEELHRFLKRNKCLIVLDDIWGKDAWDCLKHVFPHETGSEIILTTRNKEVALYADPRGVLHEPQLLTCEESWELLEKISLSGRENIEPMLVKKMEEIGKQIVVRCGGLPLAITVLGGLLATKSTWNEWQRVCENIKSYVSNGGSSNGSKNMLVADVLCLSYEYLPPHVKQCFLYFAHYPEDYEVHVGTLVSYCIAEGMVMPVKHTEAGTTVEDVGQDYLEELVKRSMVMVGRRDIVTSEVMTCRMHDLMREVCLQKAKQESFVQVIDSRDQDEAEAFISLSTNTSRRISVQLHGGAEEHHIKSLSQVSFRKMKLLRVLDLEGAQIEGGKLPDDVGDLIHLRNLSVRLTNVKELTSSIGNLKLMITLDLFVKGQLYIPNQLWDFPVGKCNPRDLLAMTSLRRLSINLSSQNTDFVVVSSLSKVLKRLRGLTINVPCEPMLPPVDVTQLVSAFTNLCELELFLKLEKLPGEQSFSSDLGALRLWQCGLVDDPFMVLEKLPNLKILQLFEGSFVGSKLCCSKNLENLEEWTVEDGAMMRLVTVELKCCNKLKSVPEGTRFLKNLQEVEIGNRTKAFKDKLISGGEDFYKVQHVPCVVFENCEL

superfamily: SSF52540
147-398 SSF52540

DSLREQRQSFPYVVEHNLVGLEQSLEKLVNDLVSGGEKLRVTSICGMGGLGKTTLAKQIFHHHKVRRHFDRFAWVYVSQDCRRRHVWQDIFLNLSYKDENQRILSLRDEQLGEELHRFLKRNKCLIVLDDIWGKDAWDCLKHVFPHETGSEIILTTRNKEVALYADPRGVLHEPQLLTCEESWELLEKISLSGRENIEPMLVKKMEEIGKQIVVRCGGLPLAITVLGGLLATKSTWNEWQRVCENIKSYVSN

HMMPfam: PF00931
IPR002182
168-459 NB-ARC,NBS
NB-ARC

EQSLEKLVNDLVSGGEKLRVTSICGMGGLGKTTLAKQIFHHHKVRRHFDRFAWVYVSQDCRRRHVWQDIFLNLSYKDENQRILSLRDEQLGEELHRFLKRNKCLIVLDDIWGKDAWDCLKHVFPHETGSEIILTTRNKEVALYADPRGVLHEPQLLTCEESWELLEKISLSGRENIEPMLVKKMEEIGKQIVVRCGGLPLAITVLGGLLATKSTWNEWQRVCENIKSYVSNGGSSNGSKNMLVADVLCLSYEYLPPHVKQCFLYFAHYPEDYEVHVGTLVSYCIAEGMVMPV

Gene3D: G3DSA:3.40.50.300
172-313 G3DSA:3.40.50.300

EKLVNDLVSGGEKLRVTSICGMGGLGKTTLAKQIFHHHKVRRHFDRFAWVYVSQDCRRRHVWQDIFLNLSYKDENQRILSLRDEQLGEELHRFLKRNKCLIVLDDIWGKDAWDCLKHVFPHETGSEIILTTRNKEVALYADP

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

VTSICGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

FLKRNKCLIVLDDIW

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CGGLPLAITVLGGLL

superfamily: SSF52058
501-825 SSF52058,LRR

RMHDLMREVCLQKAKQESFVQVIDSRDQDEAEAFISLSTNTSRRISVQLHGGAEEHHIKSLSQVSFRKMKLLRVLDLEGAQIEGGKLPDDVGDLIHLRNLSVRLTNVKELTSSIGNLKLMITLDLFVKGQLYIPNQLWDFPVGKCNPRDLLAMTSLRRLSINLSSQNTDFVVVSSLSKVLKRLRGLTINVPCEPMLPPVDVTQLVSAFTNLCELELFLKLEKLPGEQSFSSDLGALRLWQCGLVDDPFMVLEKLPNLKILQLFEGSFVGSKLCCSKNLENLEEWTVEDGAMMRLVTVELKCCNKLKSVPEGTRFLKNLQEVEIGN

Gene3D: G3DSA:3.80.10.10
556-824 G3DSA:3.80.10.10

HHIKSLSQVSFRKMKLLRVLDLEGAQIEGGKLPDDVGDLIHLRNLSVRLTNVKELTSSIGNLKLMITLDLFVKGQLYIPNQLWDFPVGKCNPRDLLAMTSLRRLSINLSSQNTDFVVVSSLSKVLKRLRGLTINVPCEPMLPPVDVTQLVSAFTNLCELELFLKLEKLPGEQSFSSDLGALRLWQCGLVDDPFMVLEKLPNLKILQLFEGSFVGSKLCCSKNLENLEEWTVEDGAMMRLVTVELKCCNKLKSVPEGTRFLKNLQEVEIG

FPrintScan: PR00364
IPR000767
567-583 DISEASERSIST
Disease resistance protein

RKMKLLRVLDLEGAQIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox