PRGDB00047002 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18407906 (NM_105061)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G63870) mRNA, complete cds.

DNA Sequence

ATGTCTCTCATGGATTCTCCTTCCTCTATTTCCTCTTGCAACTACAGATTCAATGTCTTCTCGAGCTTCCACGGGCCGAATGTTCGTAAAACACTTCTTAGTCACATGCGCAAACAGTTTAATTTCAACGGGATCACTATGTTCGATGATCAAGGGATTGAGAGAAGTGAAGAGATCGTACCTTCACTCAAAAAGGCTATAAAAGAATCGAGGATCTCGATCGTGATTCTTTCCAAGAAATATGCTTTGTCAAGATGGTGTTTGGATGAATTGGTGGAGATATTAAAGTGCAAGGAAGTTATGGGACACATAGTGATGACCATCTTCTACGGAGTGGAGCCATCTGATGTACGGAAGCAGACCGGGGAATTCGGGTTCCATTTTAATGAAACGTGTGCACATAGGACGGACGAGGACAAGCAGAATTGGAGCAAAGCTTTGAAGGATGTGGGCAACATTGCTGGAGAAGACTTCTTAAGATGGGATAATGAAGCCAAAATGATAGAGAAGATTGCTAGAGATGTTTCAGATAAACTGAATGCTACACCTTCTAGAGATTTTAATGGCATGGTGGGACTTGAAGCTCATTTGACAGAAATGGAGTCTTTGCTAGATTTAGATTATGATGGAGTTAAGATGGTTGGAATCTCTGGTCCTGCAGGGATTGGTAAGACAACAATTGCCAGAGCTTTACAAAGTCGACTCTCTAATAAGTTTCAACTCACTTGTTTTGTGGACAACCTCAAGGAAAGCTTTCTTAATAGTTTAGATGAGTTGCGTTTACAAGAACAGTTTCTTGCAAAGGTTTTGAACCATGATGGAATTAGGATATGCCATTCAGGTGTGATAGAAGAAAGGTTGTGCAAGCAGAGAGTACTCATCATTCTTGATGATGTAAACCACATAATGCAATTAGAGGCGTTGGCAAATGAAACTACATGGTTTGGTTCTGGAAGTAGGATTGTAGTTACTACAGAAAACAAAGAGATTTTGCAGCAACATGGTATCAACGATCTGTACCACGTGGGTTTTCCATCTGATGAACAAGCTTTCGAGATTTTATGTCGATATGCTTTTAGAAAAACCACTCTTTCTCATGGTTTTGAAAAGCTTGCTAGAAGAGTAACGAAGCTTTGTGGTAACCTTCCATTGGGTCTTCGTGTATTGGGTTCATCTTTACGTGGGAAGAATGAGGAAGAGTGGGAAGAAGTAATACGCAGGCTAGAAACTATACTTGATCATCAAGATATCGAGGAAGTACTCAGAGTCGGTTATGGGAGTTTACATGAGAACGAGCAATCTCTATTTCTTCATATTGCAGTCTTCTTCAACTATACAGATGGTGATCTTGTGAAAGCCATGTTCACTGACAACAACTTGGATATCAAACACGGGTTGAAAATCTTAGCAGACAAATCTCTCATAAACATATCTAACAACAGAGAAATAGTGATCCACAAGTTATTGCAACAATTTGGTAGACAAGCCGTTCATAAAGAAGAACCTTGGAAACACAAGATTTTAATACATGCTCCAGAGATTTGTGATGTCCTTGAATATGCCACAGGTACTAAAGCTATGTCCGGCATATCATTTGATATATCTGGTGTCGATGAAGTTGTTATAAGCGGTAAATCTTTTAAAAGAATACCTAATCTTCGATTCCTCAAAGTCTTTAAAAGTAGAGATGATGGCAATGATAGAGTGCACATACCTGAGGAGACAGAGTTTCCGCGTCGTCTAAGGTTACTACATTGGGAGGCATACCCATGCAAGAGTCTTCCTCCTACATTTCAACCTCAATATCTTGTCGAGCTCTATATGCCAAGTAGCCAGCTTGAAAAGCTATGGGAAGGAACACAGCGCCTTACACATCTCAAGAAGATGAATTTGTTTGCGTCTCGACATTTGAAGGAACTTCCGGATCTTTCAAATGCTACAAATCTGGAGAGAATGGATCTGAGTTATTGCGAAAGTTTGGTAGAGATCCCATCCTCTTTTTCGCATCTTCATAAACTAGAGTGGTTGGAGATGAATAACTGCATAAACCTACAAGTCATTCCAGCTCACATGAACTTAGCATCCCTTGAAACCGTCAATATGAGAGGATGCTCAAGATTGAGAAATATTCCAGTTATGTCAACAAACATCACTCAACTGTATGTATCACGGACAGCAGTTGAAGGAATGCCTCCATCAATTAGGTTTTGCTCTCGTCTCGAACGTCTCAGTATAAGCAGCAGTGGAAAGCTCAAGGGAATAACACATCTCCCCATCAGTTTAAAACAGCTAGACCTCATTGATTCTGATATTGAAACGATTCCAGAGTGCATCAAATCTCTTCATCTGCTATATATCCTTAATCTATCTGGCTGCAGGAGACTAGCATCATTGCCAGAACTCCCTAGCTCACTTAGATTTCTTATGGCAGACGATTGTGAATCATTGGAGACCGTATTTTGCCCTTTGAATACGCCAAAAGCAGAGCTCAATTTCACCAACTGCTTCAAATTAGGCCAGCAAGCACAAAGAGCAATTGTACAACGATCATTACTTCTTGGAACAACGCTCTTACCGGGAAGAGAATTACCAGCGGAATTCGATCACCAAGGCAAAGGAAATACATTGACCATTCGTCCAGGCACAGGCTTTGTGGTTTGCATTGTGATTTCCCCCAACTTGGCATCGCAAATCACAGAGTACAGGCTTCCTCAACTATTGTGTCGTCGTCGCATAGGTCAAGGCGACTTAGACCCCATTGAAAAGGTGTTCAACGTACGAACTCTACTCAACTTTCAAACGGAACATCTATTTGTGTTTATCATTCACCCTCACTTGCCATTTATCGATCCCTCTGAAGTGAGCAGAGAGATAGTGTTCGAATTCAGTAGCAAATTCAACCACTTTGATGTTATTGATTGTGGAGCCAAGTTCTTGACCGACGGGAGCATCAAAGGGAGTTATGATTCTGGATTGGAACAAGTGTTTGAAGACAACACCAAACACGGTGACCATGCAGATTGTTGGAATTGGCTATTCCACTGTTTTGATCTACCCCATTTTGTGAAAAACGTCAGAAGCTTTGTCTCAGTATGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MSLMDSPSSISSCNYRFNVFSSFHGPNVRKTLLSHMRKQFNFNGITMFDDQGIERSEEIVPSLKKAIKESRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALKDVGNIAGEDFLRWDNEAKMIEKIARDVSDKLNATPSRDFNGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIARALQSRLSNKFQLTCFVDNLKESFLNSLDELRLQEQFLAKVLNHDGIRICHSGVIEERLCKQRVLIILDDVNHIMQLEALANETTWFGSGSRIVVTTENKEILQQHGINDLYHVGFPSDEQAFEILCRYAFRKTTLSHGFEKLARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVIRRLETILDHQDIEEVLRVGYGSLHENEQSLFLHIAVFFNYTDGDLVKAMFTDNNLDIKHGLKILADKSLINISNNREIVIHKLLQQFGRQAVHKEEPWKHKILIHAPEICDVLEYATGTKAMSGISFDISGVDEVVISGKSFKRIPNLRFLKVFKSRDDGNDRVHIPEETEFPRRLRLLHWEAYPCKSLPPTFQPQYLVELYMPSSQLEKLWEGTQRLTHLKKMNLFASRHLKELPDLSNATNLERMDLSYCESLVEIPSSFSHLHKLEWLEMNNCINLQVIPAHMNLASLETVNMRGCSRLRNIPVMSTNITQLYVSRTAVEGMPPSIRFCSRLERLSISSSGKLKGITHLPISLKQLDLIDSDIETIPECIKSLHLLYILNLSGCRRLASLPELPSSLRFLMADDCESLETVFCPLNTPKAELNFTNCFKLGQQAQRAIVQRSLLLGTTLLPGRELPAEFDHQGKGNTLTIRPGTGFVVCIVISPNLASQITEYRLPQLLCRRRIGQGDLDPIEKVFNVRTLLNFQTEHLFVFIIHPHLPFIDPSEVSREIVFEFSSKFNHFDVIDCGAKFLTDGSIKGSYDSGLEQVFEDNTKHGDHADCWNWLFHCFDLPHFVKNVRSFVSV

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
14-150 G3DSA:3.40.50.10140

NYRFNVFSSFHGPNVRKTLLSHMRKQFNFNGITMFDDQGIERSEEIVPSLKKAIKESRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALKDV

ProfileScan: PS50104
IPR000157
15-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YRFNVFSSFHGPNVRKTLLSHMRKQFNFNGITMFDDQGIERSEEIVPSLKKAIKESRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALKDVGNI

HMMSmart: SM00255
IPR000157
16-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RFNVFSSFHGPNVRKTLLSHMRKQFNFNGITMFDDQGIERSEEIVPSLKKAIKESRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALKDVGNI

HMMPfam: PF01582
IPR000157
19-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFSSFHGPNVRKTLLSHMRKQFNFNGITMFDDQGIERSEEIVPSLKKAIKESRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALK

HMMPanther: PTHR11017
39-999 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFNFNGITMFDDQGIERSEEIVPSLKKAIKESRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALKDVGNIAGEDFLRWDNEAKMIEKIARDVSDKLNATPSRDFNGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIARALQSRLSNKFQLTCFVDNLKESFLNSLDELRLQEQFLAKVLNHDGIRICHSGVIEERLCKQRVLIILDDVNHIMQLEALANETTWFGSGSRIVVTTENKEILQQHGINDLYHVGFPSDEQAFEILCRYAFRKTTLSHGFEKLARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVIRRLETILDHQDIEEVLRVGYGSLHENEQSLFLHIAVFFNYTDGDLVKAMFTDNNLDIKHGLKILADKSLINISNNREIVIHKLLQQFGRQAVHKEEPWKHKILIHAPEICDVLEYATGTKAMSGISFDISGVDEVVISGKSFKRIPNLRFLKVFKSRDDGNDRVHIPEETEFPRRLRLLHWEAYPCKSLPPTFQPQYLVELYMPSSQLEKLWEGTQRLTHLKKMNLFASRHLKELPDLSNATNLERMDLSYCESLVEIPSSFSHLHKLEWLEMNNCINLQVIPAHMNLASLETVNMRGCSRLRNIPVMSTNITQLYVSRTAVEGMPPSIRFCSRLERLSISSSGKLKGITHLPISLKQLDLIDSDIETIPECIKSLHLLYILNLSGCRRLASLPELPSSLRFLMADDCESLETVFCPLNTPKAELNFTNCFKLGQQAQRAIVQRSLLLGTTLLPGRELPAEFDHQGKGNTLTIRPGTGFVVCIVISPNLASQITEYRLPQLLCRRRIGQGDLDPIEKVFNVRTLLNFQTEHLFVFIIHPHLPFIDPSEVSREIVFEFSSKFNHFDVIDCGAKFLTDGSIKGSYDSGLEQVFEDN

HMMPanther: PTHR11017:SF20
39-999 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFNFNGITMFDDQGIERSEEIVPSLKKAIKESRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALKDVGNIAGEDFLRWDNEAKMIEKIARDVSDKLNATPSRDFNGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIARALQSRLSNKFQLTCFVDNLKESFLNSLDELRLQEQFLAKVLNHDGIRICHSGVIEERLCKQRVLIILDDVNHIMQLEALANETTWFGSGSRIVVTTENKEILQQHGINDLYHVGFPSDEQAFEILCRYAFRKTTLSHGFEKLARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVIRRLETILDHQDIEEVLRVGYGSLHENEQSLFLHIAVFFNYTDGDLVKAMFTDNNLDIKHGLKILADKSLINISNNREIVIHKLLQQFGRQAVHKEEPWKHKILIHAPEICDVLEYATGTKAMSGISFDISGVDEVVISGKSFKRIPNLRFLKVFKSRDDGNDRVHIPEETEFPRRLRLLHWEAYPCKSLPPTFQPQYLVELYMPSSQLEKLWEGTQRLTHLKKMNLFASRHLKELPDLSNATNLERMDLSYCESLVEIPSSFSHLHKLEWLEMNNCINLQVIPAHMNLASLETVNMRGCSRLRNIPVMSTNITQLYVSRTAVEGMPPSIRFCSRLERLSISSSGKLKGITHLPISLKQLDLIDSDIETIPECIKSLHLLYILNLSGCRRLASLPELPSSLRFLMADDCESLETVFCPLNTPKAELNFTNCFKLGQQAQRAIVQRSLLLGTTLLPGRELPAEFDHQGKGNTLTIRPGTGFVVCIVISPNLASQITEYRLPQLLCRRRIGQGDLDPIEKVFNVRTLLNFQTEHLFVFIIHPHLPFIDPSEVSREIVFEFSSKFNHFDVIDCGAKFLTDGSIKGSYDSGLEQVFEDN

superfamily: SSF52540
70-437 SSF52540

SRISIVILSKKYALSRWCLDELVEILKCKEVMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETCAHRTDEDKQNWSKALKDVGNIAGEDFLRWDNEAKMIEKIARDVSDKLNATPSRDFNGMVGLEAHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIARALQSRLSNKFQLTCFVDNLKESFLNSLDELRLQEQFLAKVLNHDGIRICHSGVIEERLCKQRVLIILDDVNHIMQLEALANETTWFGSGSRIVVTTENKEILQQHGINDLYHVGFPSDEQAFEILCRYAFRKTTLSHGFEKLARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVIRRLETILDHQDIEEVLRVGYGSLHENEQSLFL

Gene3D: G3DSA:3.40.50.300
181-220 G3DSA:3.40.50.300

ATPSRDFNGMVGLEAHLTEMESLLDLDYDGVKMVGISGPA

HMMPfam: PF00931
IPR002182
195-447 NB-ARC,NBS
NB-ARC

AHLTEMESLLDLDYDGVKMVGISGPAGIGKTTIARALQSRLSNKFQLTCFVDNLKESFLNSLDELRLQEQFLAKVLNHDGIRICHSGVIEERLCKQRVLIILDDVNHIMQLEALANETTWFGSGSRIVVTTENKEILQQHGINDLYHVGFPSDEQAFEILCRYAFRKTTLSHGFEKLARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVIRRLETILDHQDIEEVLRVGYGSLHENEQSLFLHIAVFFNYTD

HMMSmart: SM00382
IPR003593
210-418 AAA,NBS
AAA+ ATPase domain

GVKMVGISGPAGIGKTTIARALQSRLSNKFQLTCFVDNLKESFLNSLDELRLQEQFLAKVLNHDGIRICHSGVIEERLCKQRVLIILDDVNHIMQLEALANETTWFGSGSRIVVTTENKEILQQHGINDLYHVGFPSDEQAFEILCRYAFRKTTLSHGFEKLARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVIRRLETILDHQDIE

FPrintScan: PR00364
IPR000767
213-228 DISEASERSIST
Disease resistance protein

MVGISGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
221-360 G3DSA:3.40.50.300

GIGKTTIARALQSRLSNKFQLTCFVDNLKESFLNSLDELRLQEQFLAKVLNHDGIRICHSGVIEERLCKQRVLIILDDVNHIMQLEALANETTWFGSGSRIVVTTENKEILQQHGINDLYHVGFPSDEQAFEILCRYAFR

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLCKQRVLIILDDVN

Gene3D: G3DSA:3.40.50.300
361-410 G3DSA:3.40.50.300

KTTLSHGFEKLARRVTKLCGNLPLGLRVLGSSLRGKNEEEWEEVIRRLET

FPrintScan: PR00364
IPR000767
379-393 DISEASERSIST
Disease resistance protein

CGNLPLGLRVLGSSL

superfamily: SSF52058
509-838 SSF52058,LRR

IHAPEICDVLEYATGTKAMSGISFDISGVDEVVISGKSFKRIPNLRFLKVFKSRDDGNDRVHIPEETEFPRRLRLLHWEAYPCKSLPPTFQPQYLVELYMPSSQLEKLWEGTQRLTHLKKMNLFASRHLKELPDLSNATNLERMDLSYCESLVEIPSSFSHLHKLEWLEMNNCINLQVIPAHMNLASLETVNMRGCSRLRNIPVMSTNITQLYVSRTAVEGMPPSIRFCSRLERLSISSSGKLKGITHLPISLKQLDLIDSDIETIPECIKSLHLLYILNLSGCRRLASLPELPSSLRFLMADDCESLETVFCPLNTPKAELNFTNCFKL

Gene3D: G3DSA:3.80.10.10
533-814 G3DSA:3.80.10.10

DISGVDEVVISGKSFKRIPNLRFLKVFKSRDDGNDRVHIPEETEFPRRLRLLHWEAYPCKSLPPTFQPQYLVELYMPSSQLEKLWEGTQRLTHLKKMNLFASRHLKELPDLSNATNLERMDLSYCESLVEIPSSFSHLHKLEWLEMNNCINLQVIPAHMNLASLETVNMRGCSRLRNIPVMSTNITQLYVSRTAVEGMPPSIRFCSRLERLSISSSGKLKGITHLPISLKQLDLIDSDIETIPECIKSLHLLYILNLSGCRRLASLPELPSSLRFLMADDCE

HMMPfam: PF07725
IPR011713
602-621 LRR_3
Leucine-rich repeat 3

YLVELYMPSSQLEKLWEGTQ

FPrintScan: PR00364
IPR000767
644-660 DISEASERSIST
Disease resistance protein

SNATNLERMDLSYCESL

HMMPfam: PF00560
IPR001611
648-670 LRR_1
Leucine-rich repeat

NLERMDLSYCESLVEIPSSFSHL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox