PRGDB00047003 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18407881 (NM_105050)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT1G63730) mRNA, complete cds.

DNA Sequence

ATGGCTTCCTCTTCTTCTTCGCCTCGAACCTGGAGATATCGCGTTTTCACGAGTTTCCATGGACCAGACGTCCGTAAAACAGTTCTCAGTCATTTACGCAAACAGTTTATCTGCAATGGGATTACCATGTTCGATGATCAACGGATCGAAAGAGGTCAAACCATTTCCCCTGAACTCACACGAGGGATTAGGGAATCTAGGATCTCGATTGTGGTGCTCTCGAAGAATTATGCTTCATCGAGCTGGTGTTTGGATGAGCTGTTGGAGATTTTGAAGTGCAAGGAAGATATTGGGCAGATAGTGATGACTGTCTTTTACGGAGTTGATCCATCTGATGTGCGTAAACAAACCGGAGAATTTGGGATCCGATTCAGTGAAACTTGGGCTCGTAAAACGGAGGAGGAGAAGCAAAAATGGAGCCAAGCTTTGAACGATGTGGGAAACATAGCCGGAGAGCACTTCTTAAACTGGGACAAGGAATCGAAGATGGTTGAGACGATTGCTAGAGATGTATCAAACAAACTAAACACTACAATCTCTAAGGATTTTGAAGATATGGTGGGTATTGAAGCACACTTGCAGAAAATGCAGTCTTTGTTACATTTAGATAATGAAGATGAAGCTATGATAGTTGGGATTTGTGGTCCTTCCGGTATTGGTAAGACTACCATTGCAAGGGCTTTACATAGCCGACTCTCTAGCAGTTTTCAGCTTACTTGTTTTATGGAGAATCTTAAGGGAAGCTATAATAGTGGTCTTGATGAGTATGGATTGAAGTTGTGTCTGCAACAACAGCTTCTTTCAAAGATTTTAAACCAGAATGATTTGAGGATATTCCATTTAGGTGCGATACCGGAAAGGCTATGCGACCAAAATGTTCTTATCATTCTTGATGGTGTGGACGATCTGCAGCAACTTGAGGCTTTGACTAATGAAACTAGTTGGTTTGGTCCTGGAAGCAGGATTATTGTAACCACGGAAGATCAAGAGCTTTTGGAGCAACATGATATCAACAATACATACCATGTGGATTTCCCAACTATAAAAGAAGCTCGTAAGATCTTTTGTAGATCTGCTTTTAGACAGAGTTCTGCACCATATGGTTTTGAAAAGCTTGTCGAAAGAGTGTTAAAACTTTGCAGTAACCTTCCCTTGGGTCTCCGTGTCATGGGTTCATCATTACGCAGAAAGAAAGAAGATGACTGGGAAAGTATATTACATAGGCAAGAAAATAGCCTTGATAGAAAGATCGAGGGAGTACTTAGAGTCGGATACGATAATTTACATAAGAACGATCAATTTCTTTTTCTCCTGATTGCATTCTTCTTCAACTACCAAGACAATGATCATGTGAAAGCAATGCTTGGTGACAGTAAATTGGATGTCAGATACGGGTTGAAAACCCTCGCATATAAATCTCTCATACAAATATCAATCAAAGGAGATATAGTGATGCATAAGTTACTACAACAAGTTGGTAAAGAAGCGGTTCAAAGACAAGATCATGGGAAACGCCAAATCCTAATAGACTCTGATGAGATTTGTGATGTCCTCGAAAATGATTCTGGTAATAGAAATGTGATGGGTATATCTTTTGATATATCCACACTCTTAAACGATGTGTATATAAGCGCAGAAGCTTTTAAAAGGATCCGTAATCTTCGTTTTCTCAGCATTTACAAGACAAGACTTGATACAAATGTTAGACTGCATCTATCCGAGGACATGGTTTTTCCACCTCAACTAAGGTTATTACATTGGGAGGTATATCCAGGAAAGAGTCTTCCTCATACATTTAGGCCGGAATATCTTGTGGAACTTAATTTGCGAGATAACCAGCTCGAGAAGCTTTGGGAAGGAATCCAGCCCCTTACAAATCTCAAGAAGATGGAATTGTTACGGTCCAGTAATTTAAAGGTACTCCCAAATCTTTCAGATGCTACAAATCTTGAGGTATTGAATCTGGCTCTTTGCGAGAGTTTGGTAGAGATTCCTCCTTCCATTGGAAATCTTCATAAGCTAGAAAAGTTGATTATGGATTTCTGTAGAAAGCTAAAAGTTGTTCCGACTCACTTCAACTTGGCATCTCTTGAATCACTCGGGATGATGGGATGCTGGCAATTGAAAAACATTCCAGATATTTCTACGAATATCACAACACTCAAAATCACAGACACAATGTTAGAAGATTTACCTCAATCAATTAGGCTCTGGTCTGGCCTACAGGTTCTCGATATATATGGCAGTGTCAATATATATCATGCCCCTGCAGAAATATATCTAGAGGGAAGAGGTGCAGATATTAAGAAAATTCCAGATTGCATCAAAGATCTTGATGGGTTAAAAGAGCTTCATATATATGGCTGTCCAAAAATCGTATCACTGCCAGAGCTCCCTAGCTCTCTTAAGAGACTAATAGTAGACACTTGTGAATCACTGGAGACACTAGTACATTTCCCTTTTGAGTCTGCAATTGAAGATCTATATTTCTCCAACTGCTTCAAATTGGGTCAAGAAGCACGTAGGGTCATTACTAAGCAATCTAGGGACGCATGGCTACCTGGAAGAAATGTACCAGCTGAGTTCCATTACCGAGCTGTTGGAAATTCCTTAACCATCCCTACAGATACCTACGAATGCAGGATTTGCGTCGTGATATCTCCTAAACAGAAGATGGTAGAATTTTTTGACTTGTTGTGTCGTCAACGCAAAAATGGTTTCTCTACTGGCCAAAAAAGACTTCAGCTTCTCCCCAAGGTCCAAGCTGAACATCTATTTATAGGCCACTTTACTCTTTCTGATAAACTGGACAGTGGGGTATTGTTGGAATTTAGCACCTCATCCAAGGACATCGACATTATTGAATGCGGTATCCAGATCTTTCACGGACACTACCGATAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSPRTWRYRVFTSFHGPDVRKTVLSHLRKQFICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDVGNIAGEHFLNWDKESKMVETIARDVSNKLNTTISKDFEDMVGIEAHLQKMQSLLHLDNEDEAMIVGICGPSGIGKTTIARALHSRLSSSFQLTCFMENLKGSYNSGLDEYGLKLCLQQQLLSKILNQNDLRIFHLGAIPERLCDQNVLIILDGVDDLQQLEALTNETSWFGPGSRIIVTTEDQELLEQHDINNTYHVDFPTIKEARKIFCRSAFRQSSAPYGFEKLVERVLKLCSNLPLGLRVMGSSLRRKKEDDWESILHRQENSLDRKIEGVLRVGYDNLHKNDQFLFLLIAFFFNYQDNDHVKAMLGDSKLDVRYGLKTLAYKSLIQISIKGDIVMHKLLQQVGKEAVQRQDHGKRQILIDSDEICDVLENDSGNRNVMGISFDISTLLNDVYISAEAFKRIRNLRFLSIYKTRLDTNVRLHLSEDMVFPPQLRLLHWEVYPGKSLPHTFRPEYLVELNLRDNQLEKLWEGIQPLTNLKKMELLRSSNLKVLPNLSDATNLEVLNLALCESLVEIPPSIGNLHKLEKLIMDFCRKLKVVPTHFNLASLESLGMMGCWQLKNIPDISTNITTLKITDTMLEDLPQSIRLWSGLQVLDIYGSVNIYHAPAEIYLEGRGADIKKIPDCIKDLDGLKELHIYGCPKIVSLPELPSSLKRLIVDTCESLETLVHFPFESAIEDLYFSNCFKLGQEARRVITKQSRDAWLPGRNVPAEFHYRAVGNSLTIPTDTYECRICVVISPKQKMVEFFDLLCRQRKNGFSTGQKRLQLLPKVQAEHLFIGHFTLSDKLDSGVLLEFSTSSKDIDIIECGIQIFHGHYR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSPRTWRYRVFTSFHGPDVRKTVLSHLRKQFICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDVGNIAGE

Gene3D: G3DSA:3.40.50.10140
9-146 G3DSA:3.40.50.10140

RTWRYRVFTSFHGPDVRKTVLSHLRKQFICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDV

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRYRVFTSFHGPDVRKTVLSHLRKQFICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDVGNI

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYRVFTSFHGPDVRKTVLSHLRKQFICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDVGNI

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFTSFHGPDVRKTVLSHLRKQFICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALN

HMMPanther: PTHR11017:SF20
36-961 PTHR11017:SF20,SUBFAMILY NOT NAMED

FICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDVGNIAGEHFLNWDKESKMVETIARDVSNKLNTTISKDFEDMVGIEAHLQKMQSLLHLDNEDEAMIVGICGPSGIGKTTIARALHSRLSSSFQLTCFMENLKGSYNSGLDEYGLKLCLQQQLLSKILNQNDLRIFHLGAIPERLCDQNVLIILDGVDDLQQLEALTNETSWFGPGSRIIVTTEDQELLEQHDINNTYHVDFPTIKEARKIFCRSAFRQSSAPYGFEKLVERVLKLCSNLPLGLRVMGSSLRRKKEDDWESILHRQENSLDRKIEGVLRVGYDNLHKNDQFLFLLIAFFFNYQDNDHVKAMLGDSKLDVRYGLKTLAYKSLIQISIKGDIVMHKLLQQVGKEAVQRQDHGKRQILIDSDEICDVLENDSGNRNVMGISFDISTLLNDVYISAEAFKRIRNLRFLSIYKTRLDTNVRLHLSEDMVFPPQLRLLHWEVYPGKSLPHTFRPEYLVELNLRDNQLEKLWEGIQPLTNLKKMELLRSSNLKVLPNLSDATNLEVLNLALCESLVEIPPSIGNLHKLEKLIMDFCRKLKVVPTHFNLASLESLGMMGCWQLKNIPDISTNITTLKITDTMLEDLPQSIRLWSGLQVLDIYGSVNIYHAPAEIYLEGRGADIKKIPDCIKDLDGLKELHIYGCPKIVSLPELPSSLKRLIVDTCESLETLVHFPFESAIEDLYFSNCFKLGQEARRVITKQSRDAWLPGRNVPAEFHYRAVGNSLTIPTDTYECRICVVISPKQKMVEFFDLLCRQRKNGFSTGQKRLQLLPKVQAEHLFIGHFTLSDKLDSGVLLEFSTSSKDIDIIECGIQIF

HMMPanther: PTHR11017
36-961 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FICNGITMFDDQRIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDVGNIAGEHFLNWDKESKMVETIARDVSNKLNTTISKDFEDMVGIEAHLQKMQSLLHLDNEDEAMIVGICGPSGIGKTTIARALHSRLSSSFQLTCFMENLKGSYNSGLDEYGLKLCLQQQLLSKILNQNDLRIFHLGAIPERLCDQNVLIILDGVDDLQQLEALTNETSWFGPGSRIIVTTEDQELLEQHDINNTYHVDFPTIKEARKIFCRSAFRQSSAPYGFEKLVERVLKLCSNLPLGLRVMGSSLRRKKEDDWESILHRQENSLDRKIEGVLRVGYDNLHKNDQFLFLLIAFFFNYQDNDHVKAMLGDSKLDVRYGLKTLAYKSLIQISIKGDIVMHKLLQQVGKEAVQRQDHGKRQILIDSDEICDVLENDSGNRNVMGISFDISTLLNDVYISAEAFKRIRNLRFLSIYKTRLDTNVRLHLSEDMVFPPQLRLLHWEVYPGKSLPHTFRPEYLVELNLRDNQLEKLWEGIQPLTNLKKMELLRSSNLKVLPNLSDATNLEVLNLALCESLVEIPPSIGNLHKLEKLIMDFCRKLKVVPTHFNLASLESLGMMGCWQLKNIPDISTNITTLKITDTMLEDLPQSIRLWSGLQVLDIYGSVNIYHAPAEIYLEGRGADIKKIPDCIKDLDGLKELHIYGCPKIVSLPELPSSLKRLIVDTCESLETLVHFPFESAIEDLYFSNCFKLGQEARRVITKQSRDAWLPGRNVPAEFHYRAVGNSLTIPTDTYECRICVVISPKQKMVEFFDLLCRQRKNGFSTGQKRLQLLPKVQAEHLFIGHFTLSDKLDSGVLLEFSTSSKDIDIIECGIQIF

superfamily: SSF52540
66-437 SSF52540

SRISIVVLSKNYASSSWCLDELLEILKCKEDIGQIVMTVFYGVDPSDVRKQTGEFGIRFSETWARKTEEEKQKWSQALNDVGNIAGEHFLNWDKESKMVETIARDVSNKLNTTISKDFEDMVGIEAHLQKMQSLLHLDNEDEAMIVGICGPSGIGKTTIARALHSRLSSSFQLTCFMENLKGSYNSGLDEYGLKLCLQQQLLSKILNQNDLRIFHLGAIPERLCDQNVLIILDGVDDLQQLEALTNETSWFGPGSRIIVTTEDQELLEQHDINNTYHVDFPTIKEARKIFCRSAFRQSSAPYGFEKLVERVLKLCSNLPLGLRVMGSSLRRKKEDDWESILHRQENSLDRKIEGVLRVGYDNLHKNDQFLFL

Gene3D: G3DSA:3.40.50.300
180-216 G3DSA:3.40.50.300

SKDFEDMVGIEAHLQKMQSLLHLDNEDEAMIVGICGP

HMMPfam: PF00931
IPR002182
190-447 NB-ARC,NBS
NB-ARC

EAHLQKMQSLLHLDNEDEAMIVGICGPSGIGKTTIARALHSRLSSSFQLTCFMENLKGSYNSGLDEYGLKLCLQQQLLSKILNQNDLRIFHLGAIPERLCDQNVLIILDGVDDLQQLEALTNETSWFGPGSRIIVTTEDQELLEQHDINNTYHVDFPTIKEARKIFCRSAFRQSSAPYGFEKLVERVLKLCSNLPLGLRVMGSSLRRKKEDDWESILHRQENSLDRKIEGVLRVGYDNLHKNDQFLFLLIAFFFNYQD

HMMSmart: SM00382
IPR003593
207-349 AAA,NBS
AAA+ ATPase domain

EAMIVGICGPSGIGKTTIARALHSRLSSSFQLTCFMENLKGSYNSGLDEYGLKLCLQQQLLSKILNQNDLRIFHLGAIPERLCDQNVLIILDGVDDLQQLEALTNETSWFGPGSRIIVTTEDQELLEQHDINNTYHVDFPTIK

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

IVGICGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
217-336 G3DSA:3.40.50.300

SGIGKTTIARALHSRLSSSFQLTCFMENLKGSYNSGLDEYGLKLCLQQQLLSKILNQNDLRIFHLGAIPERLCDQNVLIILDGVDDLQQLEALTNETSWFGPGSRIIVTTEDQELLEQHD

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

RLCDQNVLIILDGVD

Gene3D: G3DSA:3.40.50.300
354-410 G3DSA:3.40.50.300

IFCRSAFRQSSAPYGFEKLVERVLKLCSNLPLGLRVMGSSLRRKKEDDWESILHRQE

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

CSNLPLGLRVMGSSL

superfamily: SSF46785
415-519 SSF46785

RKIEGVLRVGYDNLHKNDQFLFLLIAFFFNYQDNDHVKAMLGDSKLDVRYGLKTLAYKSLIQISIKGDIVMHKLLQQVGKEAVQRQDHGKRQILIDSDEICDVLE

superfamily: SSF52058
539-852 SSF52058,LRR

NDVYISAEAFKRIRNLRFLSIYKTRLDTNVRLHLSEDMVFPPQLRLLHWEVYPGKSLPHTFRPEYLVELNLRDNQLEKLWEGIQPLTNLKKMELLRSSNLKVLPNLSDATNLEVLNLALCESLVEIPPSIGNLHKLEKLIMDFCRKLKVVPTHFNLASLESLGMMGCWQLKNIPDISTNITTLKITDTMLEDLPQSIRLWSGLQVLDIYGSVNIYHAPAEIYLEGRGADIKKIPDCIKDLDGLKELHIYGCPKIVSLPELPSSLKRLIVDTCESLETLVHFPFESAIEDLYFSNCFKLGQEARRVITKQSRDAW

Gene3D: G3DSA:3.80.10.10
543-832 G3DSA:3.80.10.10

ISAEAFKRIRNLRFLSIYKTRLDTNVRLHLSEDMVFPPQLRLLHWEVYPGKSLPHTFRPEYLVELNLRDNQLEKLWEGIQPLTNLKKMELLRSSNLKVLPNLSDATNLEVLNLALCESLVEIPPSIGNLHKLEKLIMDFCRKLKVVPTHFNLASLESLGMMGCWQLKNIPDISTNITTLKITDTMLEDLPQSIRLWSGLQVLDIYGSVNIYHAPAEIYLEGRGADIKKIPDCIKDLDGLKELHIYGCPKIVSLPELPSSLKRLIVDTCESLETLVHFPFESAIEDLYFSN

HMMPfam: PF07725
IPR011713
603-622 LRR_3
Leucine-rich repeat 3

YLVELNLRDNQLEKLWEGIQ

FPrintScan: PR00364
IPR000767
622-638 DISEASERSIST
Disease resistance protein

QPLTNLKKMELLRSSNL

HMMPfam: PF00560
IPR001611
649-671 LRR_1
Leucine-rich repeat

NLEVLNLALCESLVEIPPSIGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox