PRGDB00047046 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186529518 (NM_123892)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, TIR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G45240) mRNA, complete cds.

DNA Sequence

ATGGATAAAAAAGAAGAAACCAAGCAACCCGACAACATAATCTACGACAAAAATGACTCATCAGTGGCTTCCTTCATCAGCTACCTCATGGCGGGTTTTGGCTGCAGAGGAATCAAGCAGTTTCTCGGAATTTATTTAGTGATTCTCTCTAGAGACTACGCATCTTCCGTGTTGTGCCTAGAGAACCTCGAATTATGCTGTGACGACAAGAAGAGCTATGAGGTGGTTCCGGTGTTCTATGGTGTAAGTCGATCGGACGTGAGGCAACAATCGGGGCCGTTTAGTGATGCGTTCACAAAGCTGGAAAGGTCAAATCCTGCAGATCATGTGACTAAGTGGCGACGCATGTTTGCGAAAATAGCAGAACTAAAAGGCCATGAGTATGATGAAGAATTAAGCGAAGAATCCGAATTTGTGGAAGAGATCGTGGAAGATGTGTATGAGCTACTTAATCCTACGGAAGAGATTAGGATCCACAGCCGGCAACTGGATATACAAAACTTGTTATGCAAGCAACAATGGGGCCTTCGCACTCTAGGCATTTTAGGTAAGCCTGGCATTGGCAAGACAACACTTGCTAGAGCGGTCTTTCGCAGAATGGTTGGAGGCTATGATGCTTCTCACTTTGTCAAGGATTTCCACACACGATATAGTGAGATGACACTTGAGCCTTTGCCTGCTCATTTCTTGTGTATGACTCAAGTCGAAGAGTTTGACCTAAACAATTCTGGCTCCGAGCAATGCCATCGCCAAAAAAGGGTTTTGATTGTTCTAGATGATGTACGAAATGAGCAAGACGCGATGTCTTTTCTTGGAGAAATTGATCAGTTTGGTCCAGGGAGCTTGATCATCATAACCTCAAGAGATAGACAAGTACTTGAGAAGTGCCATCTCAACGAGATTTATGAGCTTAACGGTCTAAATGGTGAAGATGCTAGGAAGCTATTCACGAGGTGTGCCTTTGGGAAAGATGTGATAGTGAAGAATCTTCCAATGATTGTTATTAAAGGTTTTGAAGGGAACCCGTCTGCTCTTCGCTCATATGCGAATAAATTTAAGGGAAAGACCACAGAAGATTCTATGAGGATCTTGTTTAAGGATGCAGTTTTTAACACAAAGAAGAACACATCTATGTGCATTTACTCCAATATTGCTATTCATGAACATAAAAGTATATTTTTGAACAAGACTGTCTTGCATGCCATACAGAACATTATATTTGATCTGGAGGAGCACCCGGATTTGGATCTTCCTAACCACGTCGCTGAGTCTATCAGTGACCTAAGGAGTCCTTGTGTGCATCATCCATCCGTGCAGGTGCAATCCTTGCCCAAACATTTTCACAGAAGGCAACTTGTTCTACTCCATGGACTTGCTTGTCAATTTTACAAACTTTGGGAAGGATATAAGAGGTTCTCGAGGTTGAGGAAAATCAATCTTGGGCACTGTGAGAAACTAGTTCAAGTTGTGGAACTATCAAACGCATGTTACCTTGAGGAAATCAATCTTCAAGACTGCAAAAACTTGGATACCTTTCCAGACACTGATCAGCTAGAGAATCTCCAATTTCTTGATCTCTCTAATTGCAGTGGGATCAAATATTTTCAAGAAAATGCTAGCAAGCTTGAGAAGCTGTGGGATGGAGCTCAGTCTACGGGGTTCCTTATACCTGAGAGAAATCCCAGATCCACCAATCTTGAGAGATTAGATCTTAGCGTTTGCTCGAGTTTGATGTTGCTTCCTCCCTCTATTGGGCATCTCCAACAATTGAAGGATTTGAACATGGAAGAAATTTCAAGAAACATTTCATATCTCTATCTTGATAAAACTGCAATAGAGGAAGTTCCACAATGGATCGAGGATATCTCTGGGCTATCTGACCTTTCGATGAGTGATAGCTGGCAGAACCACCCTGAGGAGATCTCCACTTCTCTCATGAGAGTAGACATGTCTGGTAACAGTTTTGAAAGACTTCCAGACACATGGACTTCCATTCAACCAAAAGATCTTATCCTTGGTAACTGCAAAAATCTCGTGTCACTACCAGAGCTCCCTGCAACGCTCTCTCTGCTAACGGCAAATAATTGTGTATCACTTGAGAGCTTATACGTTCATGGAAATGTTCTAACCGTCTCTTTACCTCGTATCTCTCTTTCCAAACAAATCTTGAGATATAAAGCTTGCATTGTGGTTGAATCAAGACCTGGGCCTGTCAATGATCCTCCAGCTGAGTTGAGCTATGGCGATGTGCAGTTTGAGTTTTTATGCCTTGACCACAGGAAGGAAATAATAAAGATAAAAGAATGCGGCATACAACTCATGGAGGTTTATAGTAGGAAAAGATCTGGAACTGAAGACGGAAACAAGCCTGCAGAGAACGACGAAGAGTTAAGGAGAATCAGGAAGCAAATGCGTGTACGCATGACCAAGCATTGGTAA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MDKKEETKQPDNIIYDKNDSSVASFISYLMAGFGCRGIKQFLGIYLVILSRDYASSVLCLENLELCCDDKKSYEVVPVFYGVSRSDVRQQSGPFSDAFTKLERSNPADHVTKWRRMFAKIAELKGHEYDEELSEESEFVEEIVEDVYELLNPTEEIRIHSRQLDIQNLLCKQQWGLRTLGILGKPGIGKTTLARAVFRRMVGGYDASHFVKDFHTRYSEMTLEPLPAHFLCMTQVEEFDLNNSGSEQCHRQKRVLIVLDDVRNEQDAMSFLGEIDQFGPGSLIIITSRDRQVLEKCHLNEIYELNGLNGEDARKLFTRCAFGKDVIVKNLPMIVIKGFEGNPSALRSYANKFKGKTTEDSMRILFKDAVFNTKKNTSMCIYSNIAIHEHKSIFLNKTVLHAIQNIIFDLEEHPDLDLPNHVAESISDLRSPCVHHPSVQVQSLPKHFHRRQLVLLHGLACQFYKLWEGYKRFSRLRKINLGHCEKLVQVVELSNACYLEEINLQDCKNLDTFPDTDQLENLQFLDLSNCSGIKYFQENASKLEKLWDGAQSTGFLIPERNPRSTNLERLDLSVCSSLMLLPPSIGHLQQLKDLNMEEISRNISYLYLDKTAIEEVPQWIEDISGLSDLSMSDSWQNHPEEISTSLMRVDMSGNSFERLPDTWTSIQPKDLILGNCKNLVSLPELPATLSLLTANNCVSLESLYVHGNVLTVSLPRISLSKQILRYKACIVVESRPGPVNDPPAELSYGDVQFEFLCLDHRKEIIKIKECGIQLMEVYSRKRSGTEDGNKPAENDEELRRIRKQMRVRMTKHW

Domains

Domain Start-End Description Sequence

ProfileScan: PS51257
1-35 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MDKKEETKQPDNIIYDKNDSSVASFISYLMAGFGC

HMMPanther: PTHR23155
2-753 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DKKEETKQPDNIIYDKNDSSVASFISYLMAGFGCRGIKQFLGIYLVILSRDYASSVLCLENLELCCDDKKSYEVVPVFYGVSRSDVRQQSGPFSDAFTKLERSNPADHVTKWRRMFAKIAELKGHEYDEELSEESEFVEEIVEDVYELLNPTEEIRIHSRQLDIQNLLCKQQWGLRTLGILGKPGIGKTTLARAVFRRMVGGYDASHFVKDFHTRYSEMTLEPLPAHFLCMTQVEEFDLNNSGSEQCHRQKRVLIVLDDVRNEQDAMSFLGEIDQFGPGSLIIITSRDRQVLEKCHLNEIYELNGLNGEDARKLFTRCAFGKDVIVKNLPMIVIKGFEGNPSALRSYANKFKGKTTEDSMRILFKDAVFNTKKNTSMCIYSNIAIHEHKSIFLNKTVLHAIQNIIFDLEEHPDLDLPNHVAESISDLRSPCVHHPSVQVQSLPKHFHRRQLVLLHGLACQFYKLWEGYKRFSRLRKINLGHCEKLVQVVELSNACYLEEINLQDCKNLDTFPDTDQLENLQFLDLSNCSGIKYFQENASKLEKLWDGAQSTGFLIPERNPRSTNLERLDLSVCSSLMLLPPSIGHLQQLKDLNMEEISRNISYLYLDKTAIEEVPQWIEDISGLSDLSMSDSWQNHPEEISTSLMRVDMSGNSFERLPDTWTSIQPKDLILGNCKNLVSLPELPATLSLLTANNCVSLESLYVHGNVLTVSLPRISLSKQILRYKACIVVESRPGPVNDPPAELSYGDVQFE

HMMPanther: PTHR23155:SF339
2-753 PTHR23155:SF339

DKKEETKQPDNIIYDKNDSSVASFISYLMAGFGCRGIKQFLGIYLVILSRDYASSVLCLENLELCCDDKKSYEVVPVFYGVSRSDVRQQSGPFSDAFTKLERSNPADHVTKWRRMFAKIAELKGHEYDEELSEESEFVEEIVEDVYELLNPTEEIRIHSRQLDIQNLLCKQQWGLRTLGILGKPGIGKTTLARAVFRRMVGGYDASHFVKDFHTRYSEMTLEPLPAHFLCMTQVEEFDLNNSGSEQCHRQKRVLIVLDDVRNEQDAMSFLGEIDQFGPGSLIIITSRDRQVLEKCHLNEIYELNGLNGEDARKLFTRCAFGKDVIVKNLPMIVIKGFEGNPSALRSYANKFKGKTTEDSMRILFKDAVFNTKKNTSMCIYSNIAIHEHKSIFLNKTVLHAIQNIIFDLEEHPDLDLPNHVAESISDLRSPCVHHPSVQVQSLPKHFHRRQLVLLHGLACQFYKLWEGYKRFSRLRKINLGHCEKLVQVVELSNACYLEEINLQDCKNLDTFPDTDQLENLQFLDLSNCSGIKYFQENASKLEKLWDGAQSTGFLIPERNPRSTNLERLDLSVCSSLMLLPPSIGHLQQLKDLNMEEISRNISYLYLDKTAIEEVPQWIEDISGLSDLSMSDSWQNHPEEISTSLMRVDMSGNSFERLPDTWTSIQPKDLILGNCKNLVSLPELPATLSLLTANNCVSLESLYVHGNVLTVSLPRISLSKQILRYKACIVVESRPGPVNDPPAELSYGDVQFE

ProfileScan: PS50104
IPR000157
36-123 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RGIKQFLGIYLVILSRDYASSVLCLENLELCCDDKKSYEVVPVFYGVSRSDVRQQSGPFSDAFTKLERSNPADHVTKWRRMFAKIAEL

superfamily: SSF52200
IPR000157
44-126 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IYLVILSRDYASSVLCLENLELCCDDKKSYEVVPVFYGVSRSDVRQQSGPFSDAFTKLERSNPADHVTKWRRMFAKIAELKGH

HMMPfam: PF01582
IPR000157
44-116 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IYLVILSRDYASSVLCLENLELCCDDKKSYEVVPVFYGVSRSDVRQQSGPFSDAFTKLERSNPADHVTKWRRM

Gene3D: G3DSA:3.40.50.10140
45-120 G3DSA:3.40.50.10140

YLVILSRDYASSVLCLENLELCCDDKKSYEVVPVFYGVSRSDVRQQSGPFSDAFTKLERSNPADHVTKWRRMFAKI

superfamily: SSF52540
136-375 SSF52540

SEFVEEIVEDVYELLNPTEEIRIHSRQLDIQNLLCKQQWGLRTLGILGKPGIGKTTLARAVFRRMVGGYDASHFVKDFHTRYSEMTLEPLPAHFLCMTQVEEFDLNNSGSEQCHRQKRVLIVLDDVRNEQDAMSFLGEIDQFGPGSLIIITSRDRQVLEKCHLNEIYELNGLNGEDARKLFTRCAFGKDVIVKNLPMIVIKGFEGNPSALRSYANKFKGKTTEDSMRILFKDAVFNTKKN

HMMPfam: PF00931
IPR002182
165-367 NB-ARC,NBS
NB-ARC

IQNLLCKQQWGLRTLGILGKPGIGKTTLARAVFRRMVGGYDASHFVKDFHTRYSEMTLEPLPAHFLCMTQVEEFDLNNSGSEQCHRQKRVLIVLDDVRNEQDAMSFLGEIDQFGPGSLIIITSRDRQVLEKCHLNEIYELNGLNGEDARKLFTRCAFGKDVIVKNLPMIVIKGFEGNPSALRSYANKFKGKTTEDSMRILFKD

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

TLGILGKPGIGKTTLA

Gene3D: G3DSA:3.40.50.300
181-322 G3DSA:3.40.50.300

ILGKPGIGKTTLARAVFRRMVGGYDASHFVKDFHTRYSEMTLEPLPAHFLCMTQVEEFDLNNSGSEQCHRQKRVLIVLDDVRNEQDAMSFLGEIDQFGPGSLIIITSRDRQVLEKCHLNEIYELNGLNGEDARKLFTRCAFG

FPrintScan: PR00364
IPR000767
248-262 DISEASERSIST
Disease resistance protein

CHRQKRVLIVLDDVR

superfamily: SSF52058
376-751 SSF52058,LRR

TSMCIYSNIAIHEHKSIFLNKTVLHAIQNIIFDLEEHPDLDLPNHVAESISDLRSPCVHHPSVQVQSLPKHFHRRQLVLLHGLACQFYKLWEGYKRFSRLRKINLGHCEKLVQVVELSNACYLEEINLQDCKNLDTFPDTDQLENLQFLDLSNCSGIKYFQENASKLEKLWDGAQSTGFLIPERNPRSTNLERLDLSVCSSLMLLPPSIGHLQQLKDLNMEEISRNISYLYLDKTAIEEVPQWIEDISGLSDLSMSDSWQNHPEEISTSLMRVDMSGNSFERLPDTWTSIQPKDLILGNCKNLVSLPELPATLSLLTANNCVSLESLYVHGNVLTVSLPRISLSKQILRYKACIVVESRPGPVNDPPAELSYGDVQ

Gene3D: G3DSA:3.80.10.10
432-714 G3DSA:3.80.10.10

CVHHPSVQVQSLPKHFHRRQLVLLHGLACQFYKLWEGYKRFSRLRKINLGHCEKLVQVVELSNACYLEEINLQDCKNLDTFPDTDQLENLQFLDLSNCSGIKYFQENASKLEKLWDGAQSTGFLIPERNPRSTNLERLDLSVCSSLMLLPPSIGHLQQLKDLNMEEISRNISYLYLDKTAIEEVPQWIEDISGLSDLSMSDSWQNHPEEISTSLMRVDMSGNSFERLPDTWTSIQPKDLILGNCKNLVSLPELPATLSLLTANNCVSLESLYVHGNVLTVSLP

FPrintScan: PR00364
IPR000767
516-532 DISEASERSIST
Disease resistance protein

DQLENLQFLDLSNCSGI

HMMPfam: PF00560
IPR001611
520-538 LRR_1
Leucine-rich repeat

NLQFLDLSNCSGIKYFQEN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox