PRGDB00047048 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186510664 (NM_001125300)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT3G44400) mRNA, complete cds.

DNA Sequence

ATGGATTCTTCTTTTTTCCTTGTCGTAGTCGCAGCTGCTATAGGCTTCTTCATACTTTTTCGAAAATTCAGATTCCAAGAAAGTAATTCTTCTTCTTTATCTCTTCCATCTCCTGCAACTTCTGTGTCTCGAAACTGGAAACACGATGTCTTCCCGAGCTTCCATGGGGCAGATGTCCGAAGAACCTTTCTTAGTCACATCAAGGAATCGTTCAGAAGAAAGGGAATTGACACATTCATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCCTGAGCTCAAAGAAGCTATCAAAGGATCAAAGATCGCAATCGTTTTGCTCTCAAGGAAATATGCTTCTTCGTCATGGTGTCTTGATGAGTTGGCCGAGATCATGAAATGCAGGGAAATGGTGGGTCAGATTGTCATGACCATTTTCTATGAAGTGGAGCCAACTGACATAAAGAAACAGACTGGTGAATTCGGAAAAGCCTTCACAAAAACATGTAGAGGTAAAACAAAAGAGCATATTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCAACAATCGCCGGATATCATTCTCACAAATGGTGCGATGAAGCGGAGATGATTGAAAAGATATCCACTGATGTTTCAAAAGATTTCGATGATTTTGTTGGGATGGCAGCTCATATGGAAAGGACGGAACAATTGTTACGCCTAGATTTGGATGAAGTAAGGATGATTGGGATTTTGGGTCCGCCTGGGATTGGTAAGACGACCATCGCTACATGTATGTTTGATCGATTCTCCAGGAGATTTCCATTTGCTGCAATCATGACGGATATCAGAGAATGCTATCCAAGACTTTGTTTGAATGAGCGCAATGCACAATTGAAACTACAAGAACAAATGTTGTCTCAGATTTTCAATCAGAAAGATACCATGATTTCTCATTTAGGAGTGGCACCAGAACGTTTGAAAGACAAGAAAGTGTTTCTCGTTCTTGATGAAGTGGGTCACTTAGGACAACTAGATGCCTTGGCGAAAGAAACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCTAGGAGTTTTGAAGGCCCATGGGATCAATCATGTTTACAAAGTGGGATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCATGTGAAGGTTTCTGTGACCTTGCTTGGGAGGTTAAGGCATTAGCTGGTGAACTCCCTTTGGGATTGAAGGTTCTAGGCTCCGCTTTGCGGGGGATGTCCAAGCCAGAGTGGGAAAGAACACTACCAAGGTTAAGAACTAGCCTCGACGGAAAAATCGGGAACATTATACAGTTCAGTTACGATGCCTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGCCTTTTTAACTACGAATCAACAACCAAAGTGAAAGAGCTTCTTGGAAAGTTCTTGGATGTGAAACAAGGTCTTCACGTATTAGCTCAGAAATCTCTCATATCCTTTTATGGAGAAACAATACGGATGCATACTCTGCTAGAACAATTTGGAAGAGAAACTTCCTGTAAGCAATTCGTTCATCATGGCTATAGGAAACATCAACTTTTGGTAGGTGAAAGGGATATATGTGAAGTGCTCGACGATGATACAAGAGATAATAGACGTTTTATAGGGATAAATTTGGATTTACGTAAGAATGAGAAAGAATTGAAAATAAGTGAGAAAACACTTGAAAGAATGCATGATTTTCAATTCGTTAGAATCAATGACGTATTTACTCATAAGGAGAGACAGAAACTGCTTCACTTCAAGATTATACATCAACCTGAGAGAGTGCAGTTAGCACTAGAAGATCTGATTTATCACTCTCCACGAATTAGATCATTGAAATGGTTTGGTTACCAGAATATATGTTTGCCTTCTACTTTTAATCCAGAGTTTCTCGTCGAACTAGATATGAGTTCCAGCAAGCTTCGGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGGATTTGAGTGATTCTGAAGACTTGAAAGAGCTTCCCAATCTTTCAACTGCAACTAATCTCGAAGAATTAAAGCTTAGACGTTGCTCAAGTTTAGTGGAGCTCCCCTCCTCTATTGAAAAACTCACCAGTCTCCAGATATTAGATCTCCACAGTTGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGAAACGCAACTAAACTTGAGAAACTAGATCTTGAAAATTGTTCGAGTCTTGTGAAGCTCCCACCATCTATCAATGCCAATAATCTCCAGGAATTGTCTCTAAGAAATTGTTCACGTGTTGTGGAGCTCCCTGCTATCGAGAATGCGACTAATCTCCGTGAATTGAAGCTCCAAAATTGCTCAAGTCTAATAGAGCTCCCTCTTTCATGGGTCAAGAGAATGTCTCGTTTACGTGTTCTGACACTCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTCCAGACTCCCTTGATTACATATATGCAGATAATTGTAAGTCCCTCGAGAGACTGGACTGTTGCTTTAACAATCCAGAGATTAGTCTATATTTTCCCAATTGCTTCAAACTGAATCAAGAAGCCAGAGATCTCATCATGCACACATCGACTTCTAGATTTGCGATGTTACCCGGTACACAAGTGCCTGCCTGCTTCATTCACCGAGCTACTTCTGGGGATTACTTGAAAATCAAGTTGAAGGAGTCGCCTTTTCCTACAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGTTAATGAAGAAATGAGTTATGATCAGAGATCGATGAGCGTTGACATTGTCATCAGTGTACACCAAGCTATCAAAGTTCAGTGTACACCAAGCTATCATCATATATATCCAGTTTTAACAGAGCATATATACACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCATATCATTCAGAAGCAATTGGAAGATAGGAGAATGCGGGATACTCCAAAGATAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MDSSFFLVVVAAAIGFFILFRKFRFQESNSSSLSLPSPATSVSRNWKHDVFPSFHGADVRRTFLSHIKESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWCDEAEMIEKISTDVSKDFDDFVGMAAHMERTEQLLRLDLDEVRMIGILGPPGIGKTTIATCMFDRFSRRFPFAAIMTDIRECYPRLCLNERNAQLKLQEQMLSQIFNQKDTMISHLGVAPERLKDKKVFLVLDEVGHLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPCEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGNIIQFSYDALCDEDKYLFLYIACLFNYESTTKVKELLGKFLDVKQGLHVLAQKSLISFYGETIRMHTLLEQFGRETSCKQFVHHGYRKHQLLVGERDICEVLDDDTRDNRRFIGINLDLRKNEKELKISEKTLERMHDFQFVRINDVFTHKERQKLLHFKIIHQPERVQLALEDLIYHSPRIRSLKWFGYQNICLPSTFNPEFLVELDMSSSKLRKLWEGTKQLRNLKWMDLSDSEDLKELPNLSTATNLEELKLRRCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNATKLEKLDLENCSSLVKLPPSINANNLQELSLRNCSRVVELPAIENATNLRELKLQNCSSLIELPLSWVKRMSRLRVLTLNNCNNLVSLPQLPDSLDYIYADNCKSLERLDCCFNNPEISLYFPNCFKLNQEARDLIMHTSTSRFAMLPGTQVPACFIHRATSGDYLKIKLKESPFPTTLRFKACIMLVKVNEEMSYDQRSMSVDIVISVHQAIKVQCTPSYHHIYPVLTEHIYTFELEVEEVTSTELVFEFISFRSNWKIGECGILQR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
44-182 G3DSA:3.40.50.10140

RNWKHDVFPSFHGADVRRTFLSHIKESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVA

ProfileScan: PS50104
IPR000157
46-184 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHDVFPSFHGADVRRTFLSHIKESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATI

HMMSmart: SM00255
IPR000157
47-184 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRRTFLSHIKESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATI

HMMPfam: PF01582
IPR000157
50-179 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRRTFLSHIKESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALE

HMMPanther: PTHR11017:SF20
62-1004 PTHR11017:SF20,SUBFAMILY NOT NAMED

TFLSHIKESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWCDEAEMIEKISTDVSKDFDDFVGMAAHMERTEQLLRLDLDEVRMIGILGPPGIGKTTIATCMFDRFSRRFPFAAIMTDIRECYPRLCLNERNAQLKLQEQMLSQIFNQKDTMISHLGVAPERLKDKKVFLVLDEVGHLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPCEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGNIIQFSYDALCDEDKYLFLYIACLFNYESTTKVKELLGKFLDVKQGLHVLAQKSLISFYGETIRMHTLLEQFGRETSCKQFVHHGYRKHQLLVGERDICEVLDDDTRDNRRFIGINLDLRKNEKELKISEKTLERMHDFQFVRINDVFTHKERQKLLHFKIIHQPERVQLALEDLIYHSPRIRSLKWFGYQNICLPSTFNPEFLVELDMSSSKLRKLWEGTKQLRNLKWMDLSDSEDLKELPNLSTATNLEELKLRRCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNATKLEKLDLENCSSLVKLPPSINANNLQELSLRNCSRVVELPAIENATNLRELKLQNCSSLIELPLSWVKRMSRLRVLTLNNCNNLVSLPQLPDSLDYIYADNCKSLERLDCCFNNPEISLYFPNCFKLNQEARDLIMHTSTSRFAMLPGTQVPACFIHRATSGDYLKIKLKESPFPTTLRFKACIMLVKVNEEMSYDQRSMSVDIVISVHQAIKVQCTPSYHHIYPVLTEHIYTFELEVEEVTSTELVFEFISFRSNWKIGECGI

HMMPanther: PTHR11017
62-1004 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TFLSHIKESFRRKGIDTFIDNNIERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWCDEAEMIEKISTDVSKDFDDFVGMAAHMERTEQLLRLDLDEVRMIGILGPPGIGKTTIATCMFDRFSRRFPFAAIMTDIRECYPRLCLNERNAQLKLQEQMLSQIFNQKDTMISHLGVAPERLKDKKVFLVLDEVGHLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPCEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGNIIQFSYDALCDEDKYLFLYIACLFNYESTTKVKELLGKFLDVKQGLHVLAQKSLISFYGETIRMHTLLEQFGRETSCKQFVHHGYRKHQLLVGERDICEVLDDDTRDNRRFIGINLDLRKNEKELKISEKTLERMHDFQFVRINDVFTHKERQKLLHFKIIHQPERVQLALEDLIYHSPRIRSLKWFGYQNICLPSTFNPEFLVELDMSSSKLRKLWEGTKQLRNLKWMDLSDSEDLKELPNLSTATNLEELKLRRCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNATKLEKLDLENCSSLVKLPPSINANNLQELSLRNCSRVVELPAIENATNLRELKLQNCSSLIELPLSWVKRMSRLRVLTLNNCNNLVSLPQLPDSLDYIYADNCKSLERLDCCFNNPEISLYFPNCFKLNQEARDLIMHTSTSRFAMLPGTQVPACFIHRATSGDYLKIKLKESPFPTTLRFKACIMLVKVNEEMSYDQRSMSVDIVISVHQAIKVQCTPSYHHIYPVLTEHIYTFELEVEEVTSTELVFEFISFRSNWKIGECGI

superfamily: SSF52540
101-464 SSF52540

SKIAIVLLSRKYASSSWCLDELAEIMKCREMVGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWCDEAEMIEKISTDVSKDFDDFVGMAAHMERTEQLLRLDLDEVRMIGILGPPGIGKTTIATCMFDRFSRRFPFAAIMTDIRECYPRLCLNERNAQLKLQEQMLSQIFNQKDTMISHLGVAPERLKDKKVFLVLDEVGHLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPCEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGNIIQFSYDALCDEDKYLFL

HMMPfam: PF00931
IPR002182
220-477 NB-ARC,NBS
NB-ARC

MERTEQLLRLDLDEVRMIGILGPPGIGKTTIATCMFDRFSRRFPFAAIMTDIRECYPRLCLNERNAQLKLQEQMLSQIFNQKDTMISHLGVAPERLKDKKVFLVLDEVGHLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPCEGFCDLAWEVKALAGELPLGLKVLGSALRGMSKPEWERTLPRLRTSLDGKIGNIIQFSYDALCDEDKYLFLYIACLFNYESTTK

Gene3D: G3DSA:3.40.50.300
228-334 G3DSA:3.40.50.300

RLDLDEVRMIGILGPPGIGKTTIATCMFDRFSRRFPFAAIMTDIRECYPRLCLNERNAQLKLQEQMLSQIFNQKDTMISHLGVAPERLKDKKVFLVLDEVGHLGQLD

HMMSmart: SM00382
IPR003593
233-373 AAA,NBS
AAA+ ATPase domain

EVRMIGILGPPGIGKTTIATCMFDRFSRRFPFAAIMTDIRECYPRLCLNERNAQLKLQEQMLSQIFNQKDTMISHLGVAPERLKDKKVFLVLDEVGHLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYP

FPrintScan: PR00364
IPR000767
236-251 DISEASERSIST
Disease resistance protein

MIGILGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
314-328 DISEASERSIST
Disease resistance protein

RLKDKKVFLVLDEVG

FPrintScan: PR00364
IPR000767
407-421 DISEASERSIST
Disease resistance protein

AGELPLGLKVLGSAL

superfamily: SSF46785
442-548 SSF46785

GKIGNIIQFSYDALCDEDKYLFLYIACLFNYESTTKVKELLGKFLDVKQGLHVLAQKSLISFYGETIRMHTLLEQFGRETSCKQFVHHGYRKHQLLVGERDICEVLD

superfamily: SSF52058
556-854 SSF52058,LRR

RFIGINLDLRKNEKELKISEKTLERMHDFQFVRINDVFTHKERQKLLHFKIIHQPERVQLALEDLIYHSPRIRSLKWFGYQNICLPSTFNPEFLVELDMSSSKLRKLWEGTKQLRNLKWMDLSDSEDLKELPNLSTATNLEELKLRRCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNATKLEKLDLENCSSLVKLPPSINANNLQELSLRNCSRVVELPAIENATNLRELKLQNCSSLIELPLSWVKRMSRLRVLTLNNCNNLVSLPQLPDSLDYIYADNCKSLERLDCCFNN

Gene3D: G3DSA:3.80.10.10
618-854 G3DSA:3.80.10.10

EDLIYHSPRIRSLKWFGYQNICLPSTFNPEFLVELDMSSSKLRKLWEGTKQLRNLKWMDLSDSEDLKELPNLSTATNLEELKLRRCSSLVELPSSIEKLTSLQILDLHSCSSLVELPSFGNATKLEKLDLENCSSLVKLPPSINANNLQELSLRNCSRVVELPAIENATNLRELKLQNCSSLIELPLSWVKRMSRLRVLTLNNCNNLVSLPQLPDSLDYIYADNCKSLERLDCCFNN

HMMPfam: PF07725
IPR011713
648-667 LRR_3
Leucine-rich repeat 3

FLVELDMSSSKLRKLWEGTK

HMMPfam: PF00560
IPR001611
694-716 LRR_1
Leucine-rich repeat

NLEELKLRRCSSLVELPSSIEKL

FPrintScan: PR00364
IPR000767
714-730 DISEASERSIST
Disease resistance protein

EKLTSLQILDLHSCSSL

HMMPfam: PF00560
IPR001611
718-738 LRR_1
Leucine-rich repeat

SLQILDLHSCSSLVELPSFGN

HMMPfam: PF00560
IPR001611
741-760 LRR_1
Leucine-rich repeat

KLEKLDLENCSSLVKLPPSI

HMMPfam: PF00560
IPR001611
764-783 LRR_1
Leucine-rich repeat

NLQELSLRNCSRVVELPAIE

HMMPfam: PF13504
786-803 LRR_7,Leucine rich repeat

TNLRELKLQNCSSLIELP

HMMPfam: PF13504
811-828 LRR_7,Leucine rich repeat

SRLRVLTLNNCNNLVSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox