PRGDB00047050 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42568352 (NM_124017)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G46470) mRNA, complete cds.

DNA Sequence

ATGGCTTCTTCTTCCTCCTCCTCTTCTCGCAATTGGTCATATCACGTTTTCCCGAGTTTCAGCGGAGAAGATGTCCGCAACACATTCCTTAGCCACTTTCTAAAAGAACTGGATAGGAAACTGATCATTTCTTTCAAAGACAATGAGATCGAGAGAAGCCAGTCACTTGATCCCGAACTTAAACATGGGATTAGAAATTCCAGAATTGCGGTGGTTGTGTTCTCCAAAACCTATGCCTCTTCAAGCTGGTGCCTTAACGAGCTACTGGAGATTGTGAAATGCAAGAAAGAGTTTGGCCAACTTGTGATACCCATTTTCTACAATTTGGATCCATCCCATGTGAGGAAACAGACCGGAGACTTTGGGAAGATCTTTGAAAAGACATGCCGAAATAAAACAGTGGATGAGAAAATCCGATGGAAGGAAGCTTTGACCGATGTAGCTAATATCCTTGGATATCATATTGTTACCTGGGATAACGAAGCAAGCATGATCGAAGAAATCGCCAATGATATTTTGGGTAAAATGAATATATCTCCATCAAATGATTTTGAGGACTTGGTCGGTATTGAAGATCATATCACAAAGATGAGTTCATTGCTGCACTTGGAATCTGAGGAAGTGAGGATGGTCGGGATATGGGGTCCCTCGGGAATTGGCAAAACGACCATTGCAAGAGCTCTATTTAGTCGACTCTCTTGTCAGTTTCAAAGTAGTGTTTTCATTGACAAGGTTTTCATATCTAAGAGTATGGAAGTTTACAGTGGAGCTAATCTTGTTGACTATAACATGAAGTTGCACTTGCAAAGAGCCTTTCTAGCTGAAATTTTTGACAAAAAGGACATAAAGATACATGTAGGTGCAATGGAAAAGATGGTAAAGCACCGGAAAGCTCTCATCGTTATTGATGATTTAGATGATCAAGATGTGCTAGATGCTTTAGCGGATCAAACTCAATGGTTTGGAAGTGGGAGTAGAATCATTGTGGTTACAGAAAATAAGCATTTTTTAAGGGCCAATCGGATTGATCACATTTACAAGGTCTGTCTCCCATCTAATGCGCTGGCTCTTGAGATGTTTTGTCGTTCTGCTTTTAAGAAGAATTCTCCTCCTGATGACTTTTTGGAGCTTTCTTCTGAAGTTGCATTGCGTGCTGGTAATCTTCCTTTGGGCCTGAACGTATTGGGTTCAAATTTACGGGGCATAAACAAAGGTTACTGGATAGATATGCTACCGAGGCTTCAAGGTTTGGATGGAAAAATAGGGAAAACACTAAGAGTCAGCTATGATGGGTTGAATAACAGAAAAGATGAAGCAATATTTCGTCACATTGCATGTATTTTCAATGGTGAGAAAGTCAGTGACATCAAACTATTACTAGCAAATAGTAACTTGGATGTTAATATCGGGCTAAAAAACCTTGTTGATAGATCCCTTATCTGTGAAAGATTCAATACTCTGGAGATGCACTCTTTGCTACAAGAATTGGGTAAGGAGATTGTCCGTACTCAGTCCAATCAGCCTGGAGAACGGGAGTTCCTTGTGGATTTGAAGGATATTTGCGATGTACTTGAACATAACACTGGTACTAAGAAGGTTTTAGGTATAACATTGGATATAGATGAGACTGACGAACTGCATATACATGAGAGCTCCTTCAAAGGAATGCACAATCTCCTTTTTCTAAAAATTTATACTAAGAAATTGGACCAGAAAAAAAAAGTTAGATGGCACTTACCGGAACGCTTCGACTATTTGCCCTCTAGACTTAGATTATTGAGGTTTGACAGATACCCATCGAAATGTCTTCCTTCTAACTTTCATCCTGAAAACCTGGTTAAGCTTCAAATGCAGCAGAGCAAACTTGAGAAGCTGTGGGACGGAGTTCATTCACTTGCAGGGCTCAGGAATATGGATTTACGGGGATCTAGAAACCTGAAAGAAATCCCAGATCTTTCAATGGCCACTAATCTAGAAACACTTAAACTCAGCAGTTGCTCGAGTTTGGTGGAACTTCCTTCGTCTATTCAGTACCTGAATAAGCTGAATGATTTGGACATGTCATACTGCGATCATTTGGAGACTATTCCCTCTGGAGTTAACCTCAAATCTCTCGATCGTCTCAATCTCAGTGGATGCTCACGGTTGAAAAGTTTTCTTGACATACCAACCAACATCTCATGGCTTGATATAGGCCAAACAGCGGACATTCCCTCTAATTTGCGTCTACAGAATCTCGATGAGCTTATATTGTGCGAAAGAGTGCAGCTGCGTACACCTCTCATGACCATGCTTTCTCCCACTTTGACGAGGTTGACTTTTTCGAACAACCCAAGTTTTGTGGAAGTCCCTTCTTCAATTCAGAATCTCTATCAACTTGAGCATTTGGAAATTATGAACTGCAGAAATCTGGTGACTCTTCCCACTGGAATAAACCTCGACTCTCTCATTTCACTTGATCTCTCTCATTGTTCTCAGTTGAAGACTTTTCCTGATATCTCAACCAACATCTCAGATCTCAATCTAAGCTACACAGCGATTGAAGAGGTTCCTTTGTCGATCGAGAAATTATCTCTCCTCTGTTACCTAGATATGAATGGATGCAGCAATTTACTATGTGTATCCCCAAACATTTCTAAACTGAAACATCTCGAGAGAGCTGACTTTTCAGACTGTGTGGAATTGACTGAAGCTAGCTGGAATGGTAGTTCAAGTGAGATGGTCAAACTTCTTCCAGCTGATAATTTCTCAACGGTCAAGCTCAACTTCATCAACTGCTTCAAGTTAGATCTAACAGCTCTTATTCAAAACCAAACATTTTTCATGCAACTGATACTAACAGGTGAAGAAGTGCCTTCATATTTCACTCACCGTACCAGTGGGGACTCTATCTCCCTACCTCACATCTCTGTATGCCAATCATTCTTCAGTTTTAGGGGTTGCACCGTGATTGATGTCGATTCTTTTTCCACAATCTCTGTTTCATTTGACATTGAAGTATGTTGTCGGTTCATAGACAGATTCGGGAACCACTTTGATTCTACTGATTTTCCAGGATACTTCATAACAACAAAGTTGGGTGGTCATCTGGTTGTCTTTGACTGTTATTTTCCCTTTAACGAAGAATTTACTACTTTTCTGGATGGTCAATTCAACTACGATCACGTGGATATACAGTTTCGTCTCACGAATGACAACTCTCAGCTCAAACTAAAAGGATGCGGTATTCTACTTTCCGAAGATGTCCCATCCCTGGATAACCGACCTTGTAGTCCAAATATTCTTCCAGGGGTTTGTGAAGATAGCGCTTTAGAGAGAAGGAGTTTCCGGACTAAAATGCGGATGATGAGGATGAGACTACTGAAGAAACTACTGAATCGCTAG


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MASSSSSSSRNWSYHVFPSFSGEDVRNTFLSHFLKELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANILGYHIVTWDNEASMIEEIANDILGKMNISPSNDFEDLVGIEDHITKMSSLLHLESEEVRMVGIWGPSGIGKTTIARALFSRLSCQFQSSVFIDKVFISKSMEVYSGANLVDYNMKLHLQRAFLAEIFDKKDIKIHVGAMEKMVKHRKALIVIDDLDDQDVLDALADQTQWFGSGSRIIVVTENKHFLRANRIDHIYKVCLPSNALALEMFCRSAFKKNSPPDDFLELSSEVALRAGNLPLGLNVLGSNLRGINKGYWIDMLPRLQGLDGKIGKTLRVSYDGLNNRKDEAIFRHIACIFNGEKVSDIKLLLANSNLDVNIGLKNLVDRSLICERFNTLEMHSLLQELGKEIVRTQSNQPGEREFLVDLKDICDVLEHNTGTKKVLGITLDIDETDELHIHESSFKGMHNLLFLKIYTKKLDQKKKVRWHLPERFDYLPSRLRLLRFDRYPSKCLPSNFHPENLVKLQMQQSKLEKLWDGVHSLAGLRNMDLRGSRNLKEIPDLSMATNLETLKLSSCSSLVELPSSIQYLNKLNDLDMSYCDHLETIPSGVNLKSLDRLNLSGCSRLKSFLDIPTNISWLDIGQTADIPSNLRLQNLDELILCERVQLRTPLMTMLSPTLTRLTFSNNPSFVEVPSSIQNLYQLEHLEIMNCRNLVTLPTGINLDSLISLDLSHCSQLKTFPDISTNISDLNLSYTAIEEVPLSIEKLSLLCYLDMNGCSNLLCVSPNISKLKHLERADFSDCVELTEASWNGSSSEMVKLLPADNFSTVKLNFINCFKLDLTALIQNQTFFMQLILTGEEVPSYFTHRTSGDSISLPHISVCQSFFSFRGCTVIDVDSFSTISVSFDIEVCCRFIDRFGNHFDSTDFPGYFITTKLGGHLVVFDCYFPFNEEFTTFLDGQFNYDHVDIQFRLTNDNSQLKLKGCGILLSEDVPSLDNRPCSPNILPGVCEDSALERRSFRTKMRMMRMRLLKKLLNR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-153 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ASSSSSSSRNWSYHVFPSFSGEDVRNTFLSHFLKELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANILGY

Gene3D: G3DSA:3.40.50.10140
9-151 G3DSA:3.40.50.10140

SRNWSYHVFPSFSGEDVRNTFLSHFLKELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANIL

ProfileScan: PS50104
IPR000157
12-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WSYHVFPSFSGEDVRNTFLSHFLKELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANI

HMMSmart: SM00255
IPR000157
13-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SYHVFPSFSGEDVRNTFLSHFLKELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANI

HMMPfam: PF01582
IPR000157
16-145 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGEDVRNTFLSHFLKELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALT

HMMPanther: PTHR11017
36-1095 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANILGYHIVTWDNEASMIEEIANDILGKMNISPSNDFEDLVGIEDHITKMSSLLHLESEEVRMVGIWGPSGIGKTTIARALFSRLSCQFQSSVFIDKVFISKSMEVYSGANLVDYNMKLHLQRAFLAEIFDKKDIKIHVGAMEKMVKHRKALIVIDDLDDQDVLDALADQTQWFGSGSRIIVVTENKHFLRANRIDHIYKVCLPSNALALEMFCRSAFKKNSPPDDFLELSSEVALRAGNLPLGLNVLGSNLRGINKGYWIDMLPRLQGLDGKIGKTLRVSYDGLNNRKDEAIFRHIACIFNGEKVSDIKLLLANSNLDVNIGLKNLVDRSLICERFNTLEMHSLLQELGKEIVRTQSNQPGEREFLVDLKDICDVLEHNTGTKKVLGITLDIDETDELHIHESSFKGMHNLLFLKIYTKKLDQKKKVRWHLPERFDYLPSRLRLLRFDRYPSKCLPSNFHPENLVKLQMQQSKLEKLWDGVHSLAGLRNMDLRGSRNLKEIPDLSMATNLETLKLSSCSSLVELPSSIQYLNKLNDLDMSYCDHLETIPSGVNLKSLDRLNLSGCSRLKSFLDIPTNISWLDIGQTADIPSNLRLQNLDELILCERVQLRTPLMTMLSPTLTRLTFSNNPSFVEVPSSIQNLYQLEHLEIMNCRNLVTLPTGINLDSLISLDLSHCSQLKTFPDISTNISDLNLSYTAIEEVPLSIEKLSLLCYLDMNGCSNLLCVSPNISKLKHLERADFSDCVELTEASWNGSSSEMVKLLPADNFSTVKLNFINCFKLDLTALIQNQTFFMQLILTGEEVPSYFTHRTSGDSISLPHISVCQSFFSFRGCTVIDVDSFSTISVSFDIEVCCRFIDRFGNHFDSTDFPGYFITTKLGGHLVVFDCYFPFNEEFTTFLDGQFNYDHVDIQFRLTNDNSQLKLKGCGILLSEDVPSLDNRPCSPNIL

HMMPanther: PTHR11017:SF20
36-1095 PTHR11017:SF20,SUBFAMILY NOT NAMED

ELDRKLIISFKDNEIERSQSLDPELKHGIRNSRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANILGYHIVTWDNEASMIEEIANDILGKMNISPSNDFEDLVGIEDHITKMSSLLHLESEEVRMVGIWGPSGIGKTTIARALFSRLSCQFQSSVFIDKVFISKSMEVYSGANLVDYNMKLHLQRAFLAEIFDKKDIKIHVGAMEKMVKHRKALIVIDDLDDQDVLDALADQTQWFGSGSRIIVVTENKHFLRANRIDHIYKVCLPSNALALEMFCRSAFKKNSPPDDFLELSSEVALRAGNLPLGLNVLGSNLRGINKGYWIDMLPRLQGLDGKIGKTLRVSYDGLNNRKDEAIFRHIACIFNGEKVSDIKLLLANSNLDVNIGLKNLVDRSLICERFNTLEMHSLLQELGKEIVRTQSNQPGEREFLVDLKDICDVLEHNTGTKKVLGITLDIDETDELHIHESSFKGMHNLLFLKIYTKKLDQKKKVRWHLPERFDYLPSRLRLLRFDRYPSKCLPSNFHPENLVKLQMQQSKLEKLWDGVHSLAGLRNMDLRGSRNLKEIPDLSMATNLETLKLSSCSSLVELPSSIQYLNKLNDLDMSYCDHLETIPSGVNLKSLDRLNLSGCSRLKSFLDIPTNISWLDIGQTADIPSNLRLQNLDELILCERVQLRTPLMTMLSPTLTRLTFSNNPSFVEVPSSIQNLYQLEHLEIMNCRNLVTLPTGINLDSLISLDLSHCSQLKTFPDISTNISDLNLSYTAIEEVPLSIEKLSLLCYLDMNGCSNLLCVSPNISKLKHLERADFSDCVELTEASWNGSSSEMVKLLPADNFSTVKLNFINCFKLDLTALIQNQTFFMQLILTGEEVPSYFTHRTSGDSISLPHISVCQSFFSFRGCTVIDVDSFSTISVSFDIEVCCRFIDRFGNHFDSTDFPGYFITTKLGGHLVVFDCYFPFNEEFTTFLDGQFNYDHVDIQFRLTNDNSQLKLKGCGILLSEDVPSLDNRPCSPNIL

superfamily: SSF52540
67-442 SSF52540

SRIAVVVFSKTYASSSWCLNELLEIVKCKKEFGQLVIPIFYNLDPSHVRKQTGDFGKIFEKTCRNKTVDEKIRWKEALTDVANILGYHIVTWDNEASMIEEIANDILGKMNISPSNDFEDLVGIEDHITKMSSLLHLESEEVRMVGIWGPSGIGKTTIARALFSRLSCQFQSSVFIDKVFISKSMEVYSGANLVDYNMKLHLQRAFLAEIFDKKDIKIHVGAMEKMVKHRKALIVIDDLDDQDVLDALADQTQWFGSGSRIIVVTENKHFLRANRIDHIYKVCLPSNALALEMFCRSAFKKNSPPDDFLELSSEVALRAGNLPLGLNVLGSNLRGINKGYWIDMLPRLQGLDGKIGKTLRVSYDGLNNRKDEAIFR

HMMPfam: PF00931
IPR002182
191-452 NB-ARC,NBS
NB-ARC

EDHITKMSSLLHLESEEVRMVGIWGPSGIGKTTIARALFSRLSCQFQSSVFIDKVFISKSMEVYSGANLVDYNMKLHLQRAFLAEIFDKKDIKIHVGAMEKMVKHRKALIVIDDLDDQDVLDALADQTQWFGSGSRIIVVTENKHFLRANRIDHIYKVCLPSNALALEMFCRSAFKKNSPPDDFLELSSEVALRAGNLPLGLNVLGSNLRGINKGYWIDMLPRLQGLDGKIGKTLRVSYDGLNNRKDEAIFRHIACIFNGEK

Gene3D: G3DSA:3.40.50.300
203-263 G3DSA:3.40.50.300

LESEEVRMVGIWGPSGIGKTTIARALFSRLSCQFQSSVFIDKVFISKSMEVYSGANLVDYN

HMMSmart: SM00382
IPR003593
207-352 AAA,NBS
AAA+ ATPase domain

EVRMVGIWGPSGIGKTTIARALFSRLSCQFQSSVFIDKVFISKSMEVYSGANLVDYNMKLHLQRAFLAEIFDKKDIKIHVGAMEKMVKHRKALIVIDDLDDQDVLDALADQTQWFGSGSRIIVVTENKHFLRANRIDHIYKVCLPS

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

MVGIWGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
291-363 G3DSA:3.40.50.300

KMVKHRKALIVIDDLDDQDVLDALADQTQWFGSGSRIIVVTENKHFLRANRIDHIYKVCLPSNALALEMFCRS

FPrintScan: PR00364
IPR000767
292-306 DISEASERSIST
Disease resistance protein

MVKHRKALIVIDDLD

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

AGNLPLGLNVLGSNL

superfamily: SSF52058
499-888 SSF52058,LRR

EIVRTQSNQPGEREFLVDLKDICDVLEHNTGTKKVLGITLDIDETDELHIHESSFKGMHNLLFLKIYTKKLDQKKKVRWHLPERFDYLPSRLRLLRFDRYPSKCLPSNFHPENLVKLQMQQSKLEKLWDGVHSLAGLRNMDLRGSRNLKEIPDLSMATNLETLKLSSCSSLVELPSSIQYLNKLNDLDMSYCDHLETIPSGVNLKSLDRLNLSGCSRLKSFLDIPTNISWLDIGQTADIPSNLRLQNLDELILCERVQLRTPLMTMLSPTLTRLTFSNNPSFVEVPSSIQNLYQLEHLEIMNCRNLVTLPTGINLDSLISLDLSHCSQLKTFPDISTNISDLNLSYTAIEEVPLSIEKLSLLCYLDMNGCSNLLCVSPNISKLKHLERAD

Gene3D: G3DSA:3.80.10.10
537-739 G3DSA:3.80.10.10

TLDIDETDELHIHESSFKGMHNLLFLKIYTKKLDQKKKVRWHLPERFDYLPSRLRLLRFDRYPSKCLPSNFHPENLVKLQMQQSKLEKLWDGVHSLAGLRNMDLRGSRNLKEIPDLSMATNLETLKLSSCSSLVELPSSIQYLNKLNDLDMSYCDHLETIPSGVNLKSLDRLNLSGCSRLKSFLDIPTNISWLDIGQTADIPS

HMMPfam: PF07725
IPR011713
611-629 LRR_3
Leucine-rich repeat 3

NLVKLQMQQSKLEKLWDGV

HMMPfam: PF00560
IPR001611
657-678 LRR_1
Leucine-rich repeat

NLETLKLSSCSSLVELPSSIQY

Gene3D: G3DSA:3.80.10.10
740-904 G3DSA:3.80.10.10

NLRLQNLDELILCERVQLRTPLMTMLSPTLTRLTFSNNPSFVEVPSSIQNLYQLEHLEIMNCRNLVTLPTGINLDSLISLDLSHCSQLKTFPDISTNISDLNLSYTAIEEVPLSIEKLSLLCYLDMNGCSNLLCVSPNISKLKHLERADFSDCVELTEASWNGSS

FPrintScan: PR00364
IPR000767
811-827 DISEASERSIST
Disease resistance protein

INLDSLISLDLSHCSQL

HMMPfam: PF00560
IPR001611
815-833 LRR_1
Leucine-rich repeat

SLISLDLSHCSQLKTFPDI

Gene3D: G3DSA:3.40.50.300
1010-1071 G3DSA:3.40.50.300

NHFDSTDFPGYFITTKLGGHLVVFDCYFPFNEEFTTFLDGQFNYDHVDIQFRLTNDNSQLKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox