PRGDB00047051 (disease resistance protein (TIR-NBS-LRR class), putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein (TIR-NBS-LRR class), putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186527043 (NM_123051)
Gene Class TNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR-NBS-LRR class), putative (AT5G36930) mRNA, complete cds.

DNA Sequence

ATGGCTCAAGGCAGGGAGCGAATTCCTGAGCGATGGACCTATGATGTGTTTGTAAGTTTCCGTGGAGCAGATGTGCGGAAGAACTTTCTGAGCCATCTTTACGATTCTCTCAGAAGATGTGGTATAAGCACATTCATGGATGATGTGGAATTGCAAAGAGGAGAATATATTTCCCCGGAGCTACTGAATGCCATTGAAACCTCGAAAATTCTCATTGTTGTTTTAACAAAGGACTACGCATCATCGGCTTGGTGTCTTGATGAACTTGTTCACATTATGAAAAGCCACAAAAATAATCCCTCTCACATGGTTTTTCCAATTTTCTTGTACGTGGACCCATCAGACATACGCTGGCAGCAAGGGTCATATGCTAAATCATTTTCTAAACACAAAAACAGTCACCCATTAAACAAGCTAAAGGATTGGAGGGAAGCTTTAACAAAAGTAGCAAATATATCTGGGTGGGACATCAAAAATCGGAATGAAGCAGAATGTATTGCAGATATCACTAGAGAGATTCTCAAAAGACTGCCCTGCCAGTACCTGCATGTACCGTCATATGCTGTAGGTCTGAGATCACGCCTACAACACATTTCTTCACTACTGAGCATAGGTTCGGATGGAGTCCGGGTTATAGTGATCTATGGAATGGGTGGGATCGGTAAAACAACATTAGCGAAAGTGGCGTTTAACGAATTCTCACATCTTTTTGAAGGATCAAGTTTCCTAGAAAATTTTAGGGAATATTCCAAGAAGCCAGAGGGAAGAACTCATCTGCAGCATCAACTTCTCTCTGACATTTTAAGGAGGAATGACATAGAGTTCAAAGGCCTTGATCATGCGGTAAAAGAAAGATTTCGCAGTAAACGTGTACTTCTTGTAGTTGATGATGTTGATGACGTACACCAGCTTAATTCAGCAGCTATAGATCGAGATTGCTTTGGCCATGGAAGTAGGATAATAATTACCACAAGAAATATGCATTTGTTAAAGCAACTAAGAGCGGAAGGAAGCTATTCACCAAAGGAACTTGATGGTGATGAATCTCTTGAACTTTTCAGTTGGCATGCATTTAGAACAAGTGAACCACCGAAAGAGTTTCTTCAGCACTCGGAAGAAGTAGTTACATACTGTGCAGGACTACCCTTGGCTGTGGAAGTCTTGGGTGCTTTTCTCATCGAGAGAAGCATTCGTGAGTGGGAAAGCACGTTAAAATTGTTGAAACGAATCCCTAATGATAACATTCAAGCGAAACTTCAGATAAGTTTTAATGCGCTAACTATCGAACAGAAAGATGTATTCTTGGACATTGCTTGTTTTTTCATTGGGGTGGATAGTTACTATGTTGCCTGCATATTGGACGGATGCAACTTATACCCTGACATAGTACTCAGTCTGCTGATGGAAAGGTGTCTCATTACTATTTCTGGTAACAATATAATGATGCATGATTTATTACGAGACATGGGAAGACAAATTGTCCGAGAAATATCTCCCAAGAAATGTGGAGAACGTAGCAGACTGTGGAGTCATAATGATGTCGTCGGTGTACTGAAAAAGAAATCAGGTACAAATGCAATAGAAGGACTTAGCCTGAAAGCCGACGTTATGGATTTCCAGTACTTCGAGGTTGAAGCATTTGCAAAGATGCAGGAGCTGAGATTGTTAGAACTTAGATATGTAGATCTCAATGGAAGCTATGAGCATTTCCCAAAAGATCTACGATGGTTGTGTTGGCATGGGTTTTCTTTAGAATGTTTTCCTATAAACTTAAGCTTGGAAAGTTTAGCCGCTTTGGACTTGCAGTACAGCAACCTTAAACGATTTTGGAAAGCTCAATCGCCTCCTCAACCAGCAAATATGGTGAAATACCTCGATCTCAGTCATTCTGTCTACCTCAGAGAGACTCCAGATTTCTCTTACTTCCCAAACGTCGAGAAGCTTATACTGATCAATTGCAAAAGCTTGGTTTTGGTTCACAAGTCAATTGGGATTCTTGACAAAAAGCTGGTACTATTAAATCTAAGCAGTTGCATCGAGCTTGACGTTCTCCCTGAGGAAATCTATAAGTTGAAGTCACTTGAATCTCTCTTTCTCTCAAACTGCTCAAAACTTGAGAGACTGGATGATGCTTTAGGGGAATTGGAATCCTTGACAACTCTTCTTGCAGATTTTACAGCTCTAAGGGAAATCCCCTCTACGATCAATCAGCTGAAGAAACTGAAAAGGTTATCTCTTAACGGCTGCAAAGGTTTATTGAGTGATGATATCGACAATCTATATTCTGAAAAGAGCCATTCTGTTTCTCTATTGCGTCCAGTCTCATTAAGTGGTTTAACCTACATGAGAATTTTATCTCTAGGTTACTGCAATCTATCTGATGAACTGATCCCGGAAGATATTGGGAGTTTATCTTTCCTCCGGGATCTTGATTTACGAGGCAACAGTTTTTGCAATTTGCCAACAGATTTCGCTACTCTACCGAATCTCGGTGAACTCCTATTGAGTGACTGCTCAAAACTTCAATCCATCCTTAGTTTACCTAGAAGCTTATTATTTTTGGACGTAGGAAAATGCATCATGTTGAAAAGAACTCCAGATATTTCTAAATGCTCGGCATTGTTTAAATTGCAACTCAACGACTGCATCAGCCTTTTTGAGATCCCAGGGATCCATAATCATGAATACCTGAGTTTCATCGTCTTGGATGGGTGCAAACTCGCATCTACTGATACTACTATTAACACCATGCTTGAGAATTGGCTTAAGAGGAACCATGAATGCATATATATCCCAGTCGATCGTCCAAACGTCATTCCAAACTGGGTTTACTTTGAGGAGGAGAAGCGTTCATTCTCTATTACAGTTCCTGAAACTGATAACTCTGATACCGTGGTAGGGTTCACCTTATGGATGAACTTCGTGTGTCCAATGGGATACAGCTCCATATACCCCCGGGCTATCATAGTGAGGAATCTTACCAGAGGCAGTGCATGGATACATAGCCTTAAGAATTCGAAAATTCGGATTCAGATGAATGCCAACCTTTTGACCAACGATTTTCACATAGTAACAGGTGACGAAATAGAAGTTGATGTTGATTGCGATGATAGATTCACGATTCTAGCAACAGGAATTGCTCTTTGTTACAAAGCAAGAGACTCCTCAGATTTTAGCTTTGGTGATATTAAGTTTACATACGAAGAAGATGATCTTGGCTATGCTAGTAATGGTATATATTTAGATTGTCATCGATCAAAGTATGGACATGATTCATTACAGGCAGTTGTACATTGGAAAATTAGTTATCCGATGGATGGGGAAACGTCAAACCTATTCGCTTGTAGCTTTTTCCCGGGAATCTCCAGGTACCAAGAAAATAATCAACCAGTTGTAGACGTGGAGGAAAGCAATCACAGACCTCGCAGGAAAATGAGAATGAGTCTATGGAAAATTTTGGGAGCAATCGGCTTCTTGACACTTGTTGTGGTTCTTGAAGTATACTTTGAACTCTTGAGCTCCATTTTTGCCAATTCGACAACTGATTACATTATGTTACCCACTTGA


Protein sequences

Name Description Sequence
disease resistance protein (TIR-NBS-LRR class), putative disease resistance protein (TIR-NBS-LRR class), putative [Arabidopsis thaliana].

MAQGRERIPERWTYDVFVSFRGADVRKNFLSHLYDSLRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALTKVANISGWDIKNRNEAECIADITREILKRLPCQYLHVPSYAVGLRSRLQHISSLLSIGSDGVRVIVIYGMGGIGKTTLAKVAFNEFSHLFEGSSFLENFREYSKKPEGRTHLQHQLLSDILRRNDIEFKGLDHAVKERFRSKRVLLVVDDVDDVHQLNSAAIDRDCFGHGSRIIITTRNMHLLKQLRAEGSYSPKELDGDESLELFSWHAFRTSEPPKEFLQHSEEVVTYCAGLPLAVEVLGAFLIERSIREWESTLKLLKRIPNDNIQAKLQISFNALTIEQKDVFLDIACFFIGVDSYYVACILDGCNLYPDIVLSLLMERCLITISGNNIMMHDLLRDMGRQIVREISPKKCGERSRLWSHNDVVGVLKKKSGTNAIEGLSLKADVMDFQYFEVEAFAKMQELRLLELRYVDLNGSYEHFPKDLRWLCWHGFSLECFPINLSLESLAALDLQYSNLKRFWKAQSPPQPANMVKYLDLSHSVYLRETPDFSYFPNVEKLILINCKSLVLVHKSIGILDKKLVLLNLSSCIELDVLPEEIYKLKSLESLFLSNCSKLERLDDALGELESLTTLLADFTALREIPSTINQLKKLKRLSLNGCKGLLSDDIDNLYSEKSHSVSLLRPVSLSGLTYMRILSLGYCNLSDELIPEDIGSLSFLRDLDLRGNSFCNLPTDFATLPNLGELLLSDCSKLQSILSLPRSLLFLDVGKCIMLKRTPDISKCSALFKLQLNDCISLFEIPGIHNHEYLSFIVLDGCKLASTDTTINTMLENWLKRNHECIYIPVDRPNVIPNWVYFEEEKRSFSITVPETDNSDTVVGFTLWMNFVCPMGYSSIYPRAIIVRNLTRGSAWIHSLKNSKIRIQMNANLLTNDFHIVTGDEIEVDVDCDDRFTILATGIALCYKARDSSDFSFGDIKFTYEEDDLGYASNGIYLDCHRSKYGHDSLQAVVHWKISYPMDGETSNLFACSFFPGISRYQENNQPVVDVEESNHRPRRKMRMSLWKILGAIGFLTLVVVLEVYFELLSSIFANSTTDYIMLPT

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AQGRERIPERWTYDVFVSFRGADVRKNFLSHLYDSLRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALTKVANISGW

Gene3D: G3DSA:3.40.50.10140
10-150 G3DSA:3.40.50.10140

ERWTYDVFVSFRGADVRKNFLSHLYDSLRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALTKVA

ProfileScan: PS50104
IPR000157
12-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WTYDVFVSFRGADVRKNFLSHLYDSLRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALTKVANI

HMMSmart: SM00255
IPR000157
13-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TYDVFVSFRGADVRKNFLSHLYDSLRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALTKVANI

HMMPfam: PF01582
IPR000157
16-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFVSFRGADVRKNFLSHLYDSLRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALT

HMMPanther: PTHR11017:SF130
37-1186 PTHR11017:SF130,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

LRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALTKVANISGWDIKNRNEAECIADITREILKRLPCQYLHVPSYAVGLRSRLQHISSLLSIGSDGVRVIVIYGMGGIGKTTLAKVAFNEFSHLFEGSSFLENFREYSKKPEGRTHLQHQLLSDILRRNDIEFKGLDHAVKERFRSKRVLLVVDDVDDVHQLNSAAIDRDCFGHGSRIIITTRNMHLLKQLRAEGSYSPKELDGDESLELFSWHAFRTSEPPKEFLQHSEEVVTYCAGLPLAVEVLGAFLIERSIREWESTLKLLKRIPNDNIQAKLQISFNALTIEQKDVFLDIACFFIGVDSYYVACILDGCNLYPDIVLSLLMERCLITISGNNIMMHDLLRDMGRQIVREISPKKCGERSRLWSHNDVVGVLKKKSGTNAIEGLSLKADVMDFQYFEVEAFAKMQELRLLELRYVDLNGSYEHFPKDLRWLCWHGFSLECFPINLSLESLAALDLQYSNLKRFWKAQSPPQPANMVKYLDLSHSVYLRETPDFSYFPNVEKLILINCKSLVLVHKSIGILDKKLVLLNLSSCIELDVLPEEIYKLKSLESLFLSNCSKLERLDDALGELESLTTLLADFTALREIPSTINQLKKLKRLSLNGCKGLLSDDIDNLYSEKSHSVSLLRPVSLSGLTYMRILSLGYCNLSDELIPEDIGSLSFLRDLDLRGNSFCNLPTDFATLPNLGELLLSDCSKLQSILSLPRSLLFLDVGKCIMLKRTPDISKCSALFKLQLNDCISLFEIPGIHNHEYLSFIVLDGCKLASTDTTINTMLENWLKRNHECIYIPVDRPNVIPNWVYFEEEKRSFSITVPETDNSDTVVGFTLWMNFVCPMGYSSIYPRAIIVRNLTRGSAWIHSLKNSKIRIQMNANLLTNDFHIVTGDEIEVDVDCDDRFTILATGIALCYKARDSSDFSFGDIKFTYEEDDLGYASNGIYLDCHRSKYGHDSLQAVVHWKISYPMDGETSNLFACSFFPGISRYQENNQPVVDVEESNHRPRRKMRMSLWKILGAIGFLTLVVVLEVYFELLSSIFANSTTDYIML

HMMPanther: PTHR11017
37-1186 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LRRCGISTFMDDVELQRGEYISPELLNAIETSKILIVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSKHKNSHPLNKLKDWREALTKVANISGWDIKNRNEAECIADITREILKRLPCQYLHVPSYAVGLRSRLQHISSLLSIGSDGVRVIVIYGMGGIGKTTLAKVAFNEFSHLFEGSSFLENFREYSKKPEGRTHLQHQLLSDILRRNDIEFKGLDHAVKERFRSKRVLLVVDDVDDVHQLNSAAIDRDCFGHGSRIIITTRNMHLLKQLRAEGSYSPKELDGDESLELFSWHAFRTSEPPKEFLQHSEEVVTYCAGLPLAVEVLGAFLIERSIREWESTLKLLKRIPNDNIQAKLQISFNALTIEQKDVFLDIACFFIGVDSYYVACILDGCNLYPDIVLSLLMERCLITISGNNIMMHDLLRDMGRQIVREISPKKCGERSRLWSHNDVVGVLKKKSGTNAIEGLSLKADVMDFQYFEVEAFAKMQELRLLELRYVDLNGSYEHFPKDLRWLCWHGFSLECFPINLSLESLAALDLQYSNLKRFWKAQSPPQPANMVKYLDLSHSVYLRETPDFSYFPNVEKLILINCKSLVLVHKSIGILDKKLVLLNLSSCIELDVLPEEIYKLKSLESLFLSNCSKLERLDDALGELESLTTLLADFTALREIPSTINQLKKLKRLSLNGCKGLLSDDIDNLYSEKSHSVSLLRPVSLSGLTYMRILSLGYCNLSDELIPEDIGSLSFLRDLDLRGNSFCNLPTDFATLPNLGELLLSDCSKLQSILSLPRSLLFLDVGKCIMLKRTPDISKCSALFKLQLNDCISLFEIPGIHNHEYLSFIVLDGCKLASTDTTINTMLENWLKRNHECIYIPVDRPNVIPNWVYFEEEKRSFSITVPETDNSDTVVGFTLWMNFVCPMGYSSIYPRAIIVRNLTRGSAWIHSLKNSKIRIQMNANLLTNDFHIVTGDEIEVDVDCDDRFTILATGIALCYKARDSSDFSFGDIKFTYEEDDLGYASNGIYLDCHRSKYGHDSLQAVVHWKISYPMDGETSNLFACSFFPGISRYQENNQPVVDVEESNHRPRRKMRMSLWKILGAIGFLTLVVVLEVYFELLSSIFANSTTDYIML

superfamily: SSF52540
171-415 SSF52540

REILKRLPCQYLHVPSYAVGLRSRLQHISSLLSIGSDGVRVIVIYGMGGIGKTTLAKVAFNEFSHLFEGSSFLENFREYSKKPEGRTHLQHQLLSDILRRNDIEFKGLDHAVKERFRSKRVLLVVDDVDDVHQLNSAAIDRDCFGHGSRIIITTRNMHLLKQLRAEGSYSPKELDGDESLELFSWHAFRTSEPPKEFLQHSEEVVTYCAGLPLAVEVLGAFLIERSIREWESTLKLLKRIPNDNI

Gene3D: G3DSA:3.40.50.300
195-333 G3DSA:3.40.50.300

LQHISSLLSIGSDGVRVIVIYGMGGIGKTTLAKVAFNEFSHLFEGSSFLENFREYSKKPEGRTHLQHQLLSDILRRNDIEFKGLDHAVKERFRSKRVLLVVDDVDDVHQLNSAAIDRDCFGHGSRIIITTRNMHLLKQL

HMMPfam: PF00931
IPR002182
197-445 NB-ARC,NBS
NB-ARC

HISSLLSIGSDGVRVIVIYGMGGIGKTTLAKVAFNEFSHLFEGSSFLENFREYSKKPEGRTHLQHQLLSDILRRNDIEFKGLDHAVKERFRSKRVLLVVDDVDDVHQLNSAAIDRDCFGHGSRIIITTRNMHLLKQLRAEGSYSPKELDGDESLELFSWHAFRTSEPPKEFLQHSEEVVTYCAGLPLAVEVLGAFLIERSIREWESTLKLLKRIPNDNIQAKLQISFNALTIEQKDVFLDIACFFIGVD

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

VIVIYGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
285-299 DISEASERSIST
Disease resistance protein

RFRSKRVLLVVDDVD

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CAGLPLAVEVLGAFL

superfamily: SSF46785
413-519 SSF46785

DNIQAKLQISFNALTIEQKDVFLDIACFFIGVDSYYVACILDGCNLYPDIVLSLLMERCLITISGNNIMMHDLLRDMGRQIVREISPKKCGERSRLWSHNDVVGVLK

superfamily: SSF52058
493-926 SSF52058,LRR

IVREISPKKCGERSRLWSHNDVVGVLKKKSGTNAIEGLSLKADVMDFQYFEVEAFAKMQELRLLELRYVDLNGSYEHFPKDLRWLCWHGFSLECFPINLSLESLAALDLQYSNLKRFWKAQSPPQPANMVKYLDLSHSVYLRETPDFSYFPNVEKLILINCKSLVLVHKSIGILDKKLVLLNLSSCIELDVLPEEIYKLKSLESLFLSNCSKLERLDDALGELESLTTLLADFTALREIPSTINQLKKLKRLSLNGCKGLLSDDIDNLYSEKSHSVSLLRPVSLSGLTYMRILSLGYCNLSDELIPEDIGSLSFLRDLDLRGNSFCNLPTDFATLPNLGELLLSDCSKLQSILSLPRSLLFLDVGKCIMLKRTPDISKCSALFKLQLNDCISLFEIPGIHNHEYLSFIVLDGCKLASTDTTINTMLENWLKRNH

Gene3D: G3DSA:3.80.10.10
542-750 G3DSA:3.80.10.10

FEVEAFAKMQELRLLELRYVDLNGSYEHFPKDLRWLCWHGFSLECFPINLSLESLAALDLQYSNLKRFWKAQSPPQPANMVKYLDLSHSVYLRETPDFSYFPNVEKLILINCKSLVLVHKSIGILDKKLVLLNLSSCIELDVLPEEIYKLKSLESLFLSNCSKLERLDDALGELESLTTLLADFTALREIPSTINQLKKLKRLSLNGCK

FPrintScan: PR00364
IPR000767
689-705 DISEASERSIST
Disease resistance protein

YKLKSLESLFLSNCSKL

Gene3D: G3DSA:3.80.10.10
773-914 G3DSA:3.80.10.10

PVSLSGLTYMRILSLGYCNLSDELIPEDIGSLSFLRDLDLRGNSFCNLPTDFATLPNLGELLLSDCSKLQSILSLPRSLLFLDVGKCIMLKRTPDISKCSALFKLQLNDCISLFEIPGIHNHEYLSFIVLDGCKLASTDTTI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox